DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant5 and GALNT9

DIOPT Version :9

Sequence 1:NP_001036338.1 Gene:Pgant5 / 326151 FlyBaseID:FBgn0031681 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001116108.1 Gene:GALNT9 / 50614 HGNCID:4131 Length:603 Species:Homo sapiens


Alignment Length:661 Identity:230/661 - (34%)
Similarity:327/661 - (49%) Gaps:100/661 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 RKMRGRMRSNTCRIVLLTSLVWVIFDFVLIARYSDCIGK--------DGWRCKRSGEYDV-ELPN 63
            ||:|          .|||..:.|....||.:.|....|:        .|.|..||....| .|.:
Human     5 RKIR----------TLLTVNILVFVGIVLFSVYCRLQGRSQELVRIVSGDRRVRSRHAKVGTLGD 59

  Fly    64 AERLVDDNQLVDDNEINTEKSLDGESGG-ALIMGQ-GFASGGISMTYPSVVLKKWFLAPSVQEAK 126
            .|.::   |.:|..|......|:|.:.. .|:.|. |...||::.|          |....|||:
Human    60 REAIL---QRLDHLEEVVYNQLNGLAKPIGLVEGPGGLGQGGLAAT----------LRDDGQEAE 111

  Fly   127 GKPGEMGKPVKIPADMKDLMKEKFKENQFNLLASDMISLNRSLTDVRHEGCRRKHYASKLPTTSI 191
            |                     |::|..:|...||.|||:||:.|.|...||:..||..||..|:
Human   112 G---------------------KYEEYGYNAQLSDRISLDRSIPDYRPRKCRQMSYAQDLPQVSV 155

  Fly   192 VIVFHNEAWTTLLRTVWSVINRSPRALLKEIILVDDASERDFLGKQLEEYVAK-LPVKTFVLRTE 255
            |.:|.|||.:.:||:|.||:|.:|..||||:|||||.|:...|...|::||.| .|....::|..
Human   156 VFIFVNEALSVILRSVHSVVNHTPSQLLKEVILVDDNSDNVELKFNLDQYVNKRYPGLVKIVRNS 220

  Fly   256 KRSGLIRARLLGAEHVSGEVITFLDAHCECTEGWLEPLLARIVQNRRTVVCPIIDVISDETFE-- 318
            :|.|||||||.|.:..:..|:.|.|||.|...||.||.|:||.::||.:|.|.||.|...|||  
Human   221 RREGLIRARLQGWKAATAPVVGFFDAHVEFNTGWAEPALSRIREDRRRIVLPAIDNIKYSTFEVQ 285

  Fly   319 -YITASDSTWGGFNWKLNFRW--YRVPSREMARRNNDRTAPLRTPTMAGGLFSIDKDYFYEIGSY 380
             |..|:.    |:||.|   |  |.:|.::...| .|.:||:|||.|.|..|.:|::||.:||..
Human   286 QYANAAH----GYNWGL---WCMYIIPPQDWLDR-GDESAPIRTPAMIGCSFVVDREYFGDIGLL 342

  Fly   381 DEGMDIWGGENLEMSFRVWMCGGVLEIAPCSRVGHVFRKSTPYTFPGGTTEIVNHNNARLVEVWL 445
            |.||:::||||:|:..|||.|||.:|:.|||||.|:.|...||.  .........|..|..|||:
Human   343 DPGMEVYGGENVELGMRVWQCGGSMEVLPCSRVAHIERTRKPYN--NDIDYYAKRNALRAAEVWM 405

  Fly   446 DDWKEFYYSFY------PGARKASAGDVSDRKALRDRLKCKSFRWYLENVYPESLMPLDYYYLGE 504
            ||:|...|..:      ||   ...||||:|.|||.||||:||:|||||||||..:..:....||
Human   406 DDFKSHVYMAWNIPMSNPG---VDFGDVSERLALRQRLKCRSFKWYLENVYPEMRVYNNTLTYGE 467

  Fly   505 IRNAETET-CLDTMGRKYNEKVGISYCHGLGGNQVFAYTK----------RQQIMSDDLCLDASS 558
            :||::... ||| .|.:..::..:..|||: .:|:..|:.          ....:.|..||....
Human   468 VRNSKASAYCLD-QGAEDGDRAILYPCHGM-SSQLVRYSADGLLQLGPLGSTAFLPDSKCLVDDG 530

  Fly   559 SNGPVNMVRCHNMGGNQEWVYDAEEKW-IRHTNTGQCLQRATRDDANTPL---LRPCSYGKGQQW 619
            :.....:.:|.::....:.::|..:.. |....||:||:.....|||..|   ::.||   ||:|
Human   531 TGRMPTLKKCEDVARPTQRLWDFTQSGPIVSRATGRCLEVEMSKDANFGLRLVVQRCS---GQKW 592

  Fly   620 LMESKFKWQAH 630
            ::.:..|...|
Human   593 MIRNWIKHARH 603

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant5NP_001036338.1 pp-GalNAc-T 190..490 CDD:133004 140/311 (45%)
Ricin_B_lectin 503..619 CDD:395527 31/130 (24%)
GALNT9NP_001116108.1 Catalytic subdomain A 150..261 52/110 (47%)
pp-GalNAc-T 154..453 CDD:133004 140/311 (45%)
Catalytic subdomain B 318..380 33/61 (54%)
Ricin_B_lectin 464..592 CDD:279046 31/132 (23%)
RICIN 466..594 CDD:238092 32/132 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152477
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.