DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant5 and Galntl5

DIOPT Version :9

Sequence 1:NP_001036338.1 Gene:Pgant5 / 326151 FlyBaseID:FBgn0031681 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001020319.1 Gene:Galntl5 / 499968 RGDID:1565271 Length:443 Species:Rattus norvegicus


Alignment Length:348 Identity:163/348 - (46%)
Similarity:230/348 - (66%) Gaps:15/348 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 NLLASDMISLNRSLTDVRHEGCRRKHYASKLPTTSIVIVFHNEAWTTLLRTVWSVINRSPRALLK 220
            |::.|..:.:.|.:.|.|::.|::|||...|||.|::|.|:||.:.||||||.||:|.||:.||:
  Rat    89 NVITSRRLGIERQVPDSRNKICQQKHYPFNLPTASVIICFYNEEFNTLLRTVSSVMNLSPKHLLE 153

  Fly   221 EIILVDDASERDFLGKQLEEYVAKLPVKTFVLRTEKRSGLIRARLLGAEHVSGEVITFLDAHCEC 285
            |||||||.||.|.|..:|:.::.....|..::|.:||.||||:|::||...||:::.|||:|||.
  Rat   154 EIILVDDMSEFDDLKAKLDYHLEIFRGKIKLVRNKKREGLIRSRMIGASRASGDILVFLDSHCEV 218

  Fly   286 TEGWLEPLLARIVQNRRTVVCPIIDVISDETFEYITASDSTWGGFNWKLNFRWYRVPSREMARRN 350
            ...||||||..|.::.:.||||:||||.:.|.:|: .|....|.|:|.|||||..|.|.|:....
  Rat   219 NRVWLEPLLHAIAKDHKMVVCPVIDVIDELTLDYV-GSPIVRGAFDWNLNFRWDDVFSYELDGPE 282

  Fly   351 NDRTAPLRTPTMAGGLFSIDKDYFYEIGSYDEGMDIWGGENLEMSFRVWMCGGVLEIAPCSRVGH 415
            ...| |:|:|.|:||:|:|::.||.|:|.||:.||:|||||:|:|.|:|||||.|.|.|||||||
  Rat   283 GPST-PIRSPAMSGGIFAINRHYFNELGQYDKDMDLWGGENVELSLRIWMCGGQLFILPCSRVGH 346

  Fly   416 VFRKSTPYTFPGGTTEIVNH-----NNARLVEVWLDDWKEFYYSFYPGARKASAGDVSDRKALRD 475
            ..:..:       ...:||.     |..|:|.||||::||.::...|.....|.|::|||..||.
  Rat   347 NNKALS-------KNRLVNQSALSKNLLRVVHVWLDEYKENFFLQRPSLTHVSCGNISDRVELRK 404

  Fly   476 RLKCKSFRWYLENVYPESLMPLD 498
            ||.||||:|||:|::|| |.||:
  Rat   405 RLGCKSFQWYLDNIFPE-LEPLN 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant5NP_001036338.1 pp-GalNAc-T 190..490 CDD:133004 146/304 (48%)
Ricin_B_lectin 503..619 CDD:395527
Galntl5NP_001020319.1 pp-GalNAc-T 123..419 CDD:133004 146/304 (48%)
Glyco_tranf_2_3 123..355 CDD:290369 117/240 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346044
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.