DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pgant5 and gly-8

DIOPT Version :9

Sequence 1:NP_001036338.1 Gene:Pgant5 / 326151 FlyBaseID:FBgn0031681 Length:630 Species:Drosophila melanogaster
Sequence 2:NP_001366981.1 Gene:gly-8 / 176595 WormBaseID:WBGene00001633 Length:421 Species:Caenorhabditis elegans


Alignment Length:379 Identity:147/379 - (38%)
Similarity:229/379 - (60%) Gaps:25/379 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LAPSVQEAKGKPGEMGKPVKIPADMKDLMKEKFKENQFNLLASDMISLNRSLTDVRHEGCRRKHY 182
            |..::.||:.|..|.|                .|...|:.|:|:.:..||::....|:.|..:.|
 Worm    55 LKENLTEAESKKSEWG----------------IKSFAFDALSSEKLGPNRNVGKQAHKLCEEEKY 103

  Fly   183 ASKLPTTSIVIVFHNEAWTTLLRTVWSVINRSPRALLKEIILVDDASERD-FLGKQLEEY--VAK 244
            .:.. :||:|::.||||.:|:||.:..:|..:|::|||||:|.:||||.| .|.|.||::  :..
 Worm   104 DASY-STSVVVIHHNEALSTILRMINGIIEFTPKSLLKEIVLYEDASEEDHVLTKHLEKFAKIKG 167

  Fly   245 LPVKTFVLRTEKRSGLIRARLLGAEHVSGEVITFLDAHCECTEGWLEPLLARIVQNRRTVVCPII 309
            |..|..:.|:|.|.|||||::..:...:||||.|:|:|||..|.||||||..|.::.:::|.|::
 Worm   168 LEDKLIIKRSEYRQGLIRAKVHASRLATGEVIVFMDSHCEVAERWLEPLLQPIKEDPKSIVLPVV 232

  Fly   310 DVISDETFEYITASDSTWGGFNWKLNFRWYRVPSREMARRNNDRTAPLRTPTMAGGLFSIDKDYF 374
            |:|:..:|:| :.|.....||:|...|:|..:|........|: ..|..:|.|.|||.::.|:||
 Worm   233 DLINPVSFDY-SPSMVAKSGFDWGFTFKWIYLPWEYFETPENN-VKPFNSPAMPGGLLAMRKEYF 295

  Fly   375 YEIGSYDEGMDIWGGENLEMSFRVWMCGGVLEIAPCSRVGHVFRKSTPYTF-PGGTTEIVNHNNA 438
            .|:|.||.||:|||.||:|:|.:.|:|||.:.:|||||||||||...|||. ||..|.:  :|..
 Worm   296 VELGEYDMGMEIWGSENIELSLKAWLCGGRVVVAPCSRVGHVFRMRRPYTSKPGMDTAL--YNAV 358

  Fly   439 RLVEVWLDDWKEFYYSFYPGARKASAGDVSDRKALRDRLKCKSFRWYLENVYPE 492
            |:.:.||.:::..:::..|...|...||:::...::||||||..:|::||||||
 Worm   359 RVAKTWLGEYESKFFAVKPRGAKMVFGDLTEPMQVKDRLKCKDMKWFIENVYPE 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pgant5NP_001036338.1 pp-GalNAc-T 190..490 CDD:133004 127/303 (42%)
Ricin_B_lectin 503..619 CDD:395527
gly-8NP_001366981.1 pp-GalNAc-T 110..410 CDD:133004 127/303 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3736
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D606683at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.