DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31650 and RCN1

DIOPT Version :9

Sequence 1:NP_001162879.1 Gene:CG31650 / 326150 FlyBaseID:FBgn0031673 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_002892.1 Gene:RCN1 / 5954 HGNCID:9934 Length:331 Species:Homo sapiens


Alignment Length:312 Identity:111/312 - (35%)
Similarity:179/312 - (57%) Gaps:21/312 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RVKDGIYAPRDAHHHGEDGE------HNVEFDHEAIIGNTKEAQEFDSLSPDESKRRLLILIKMM 102
            |.|..:...|......|.||      .:.::||||.:|. ::::.||.|:|||||.||..::..:
Human    28 RAKPTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGK-EDSKTFDQLTPDESKERLGKIVDRI 91

  Fly   103 DLNKDEFIDRHELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAM---EDEDFK 164
            |.:.|.|:...|||.||.|..|:...:..|..:::.|:|.|::|:|:||.|.||..   ...:| 
Human    92 DNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEF- 155

  Fly   165 KETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDA 229
            .::.|:.::   :||:.:|:..|.|||.|.|...|.|||..|.:|||...|..|::..|::|.|.
Human   156 HDSSDHHTF---KKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDK 217

  Fly   230 DHDGKINFQEFVGDAASHHDK----EWLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIAN 290
            :.||.::..|::.|..||.:.    :|:::|:|:|::..|.|.||.|..||:..||:|.:...|.
Human   218 NGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQ 282

  Fly   291 DEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATDYGDHLQNINHLSDEL 342
            .|..||...:|::.|::|:..|||.|::.||||:||:||:.|.. ||  |||
Human   283 AEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTK-NH--DEL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31650NP_001162879.1 EF-hand_7 100..153 CDD:290234 18/52 (35%)
EFh 100..153 CDD:298682 18/52 (35%)
EF-hand_7 184..241 CDD:290234 22/56 (39%)
EFh 184..241 CDD:298682 22/56 (39%)
EFh 228..281 CDD:298682 18/56 (32%)
RCN1NP_002892.1 EFh_CREC_RCN1 48..314 CDD:320027 92/270 (34%)
EF-hand motif 48..76 CDD:320027 7/28 (25%)
EF-hand motif 83..112 CDD:320027 11/28 (39%)
EF-hand motif 119..148 CDD:320027 11/28 (39%)
EF-hand motif 170..199 CDD:320027 13/28 (46%)
EF-hand motif 207..236 CDD:320027 8/28 (29%)
EF-hand motif 248..277 CDD:320027 13/28 (46%)
EF-hand motif 284..313 CDD:320027 10/28 (36%)
Prevents secretion from ER 328..331 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4223
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D372250at33208
OrthoFinder 1 1.000 - - FOG0000638
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.