DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31650 and RCN3

DIOPT Version :9

Sequence 1:NP_001162879.1 Gene:CG31650 / 326150 FlyBaseID:FBgn0031673 Length:342 Species:Drosophila melanogaster
Sequence 2:XP_024307388.1 Gene:RCN3 / 57333 HGNCID:21145 Length:365 Species:Homo sapiens


Alignment Length:387 Identity:121/387 - (31%)
Similarity:179/387 - (46%) Gaps:79/387 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PLTLCAVALL--AAVG-PMPAHGAVANSHKHEKHLSKERVKDGIYAP-RDAHHHGEDGEHNVEFD 69
            |..|..:.||  .|.| |.|..|.......|:.            || .||.|  :|...|.::|
Human     5 PSVLLLLLLLRHGAQGKPSPDAGPHGQGRVHQA------------APLSDAPH--DDAHGNFQYD 55

  Fly    70 HEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDL--NKDEFIDRHELKAWILRSFKKLSEEEAA 132
            |||.:|. :.|:|||.|:|:||:.||..::..||.  :.|.::...||:|||..:.::...:..:
Human    56 HEAFLGR-EVAKEFDQLTPEESQARLGRIVDRMDRAGDGDGWVSLAELRAWIAHTQQRHIRDSVS 119

  Fly   133 DRFEEIDQDADERITWKEYLQDTYA--MEDEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKD 195
            ..::..|.|.|.|:.|:|....||.  ...|:|.    |.:..|..:||:.:|:..|..||.:.|
Human   120 AAWDTYDTDRDGRVGWEELRNATYGHYAPGEEFH----DVEDAETYKKMLARDERRFRVADQDGD 180

  Fly   196 GVLTLEEFVLFQNPEEHPQM-------------------------------------LPILLEHT 223
            .:.|.||...|.:|||.|.|                                     .|.||:.|
Human   181 SMATREELTAFLHPEEFPHMRDIVIALPGAKFPREPLTLTPGVQPPPGARVIGPQPQCPFLLQET 245

  Fly   224 MQDKDADHDGKINFQEFVGDAAS----HHDKEWLITEKERFDKDHDSNGDGVLTGDEVLSWIVPS 284
            ::|.|.:.||.:..:|::.|..|    ..:..|:.||:::|....|.|.||.|.|.||..|::|.
Human   246 LEDLDRNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGHLDGSEVGHWVLPP 310

  Fly   285 NTAIAND----EVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATDYGDHLQNINHLSDEL 342
                |.|    |.:||...:|.|.|.|||..|||.|::.||||:||:||:.|.. :|  |||
Human   311 ----AQDQPLVEANHLLHESDTDKDGRLSKAEILGNWNMFVGSQATNYGEDLTR-HH--DEL 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31650NP_001162879.1 EF-hand_7 100..153 CDD:290234 14/54 (26%)
EFh 100..153 CDD:298682 14/54 (26%)
EF-hand_7 184..241 CDD:290234 22/93 (24%)
EFh 184..241 CDD:298682 22/93 (24%)
EFh 228..281 CDD:298682 18/56 (32%)
RCN3XP_024307388.1 EFh_CREC_RCN3 44..348 CDD:320028 95/314 (30%)
EF-hand motif 44..73 CDD:320028 13/31 (42%)
EF-hand motif 79..110 CDD:320028 10/30 (33%)
EF-hand motif 117..146 CDD:320028 8/28 (29%)
EF-hand motif 167..196 CDD:320028 10/28 (36%)
EF-hand motif 204..270 CDD:320028 11/65 (17%)
EF-hand motif 282..311 CDD:320028 12/32 (38%)
EF-hand motif 318..348 CDD:320028 14/29 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4223
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D372250at33208
OrthoFinder 1 1.000 - - FOG0000638
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.