DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31650 and CG31475

DIOPT Version :9

Sequence 1:NP_001162879.1 Gene:CG31650 / 326150 FlyBaseID:FBgn0031673 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001262725.1 Gene:CG31475 / 42303 FlyBaseID:FBgn0051475 Length:418 Species:Drosophila melanogaster


Alignment Length:314 Identity:71/314 - (22%)
Similarity:138/314 - (43%) Gaps:27/314 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KHEKHLSKERVKDGIYAPRDAHHHGEDGEHNVEFDHEAIIGNTKEAQEFDSLSPDESKRRLLILI 99
            |||:.:..:.|.:.:.: |:.::|.:....:.:..:.:...|..|.....:.:.:| |:.|....
  Fly   102 KHEQSMRLQPVANNLDS-RNENNHRQPHPQSQKVQNASKSPNQPETVILAASNVNE-KQILAKAF 164

  Fly   100 KMMDLNKDEFIDRHELKAWILRSFKKLSEE---EAADRFEEID-QDADERITWKEY--------- 151
            |..|.::|..:...||..:|.|...:..:|   ..|..|..:| ..||..|||.||         
  Fly   165 KRADRSRDGILSIQELGQYINRRIVEHIDEAIMNNAREFRRVDIGPADGLITWDEYHRFFLREHG 229

  Fly   152 LQDTYAMEDEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQML 216
            :.:....|.::.:...::..:.||    :.:||..::.|.......||::|::.|::||.....|
  Fly   230 MTEADIDEHDEIRHTALNRRARED----MMRDKARWSEAARTDLFTLTIDEYLSFRHPESSVSNL 290

  Fly   217 PILLEHTMQDKDADHDGKINFQEFVGDAASHHD--------KEWLITEKERFDKDHDSNGDGVLT 273
            ..|::..::..|.|.|.::..:||........|        .:.|:..:|.|.:..|.|.||...
  Fly   291 LELVDDLLRQFDQDGDDQLTLEEFSDLNVDDDDDLMRKSLISKTLVERREEFKRIIDKNHDGKAD 355

  Fly   274 GDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATD 327
            ..|:|:::.|.....|..|...||...||:.|:.|:..|:.::.:.|:.|:..|
  Fly   356 RGELLNYVNPKTPRYALQEAATLFSLCDENKDELLTLKEMTDHAEIFLQSKMID 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31650NP_001162879.1 EF-hand_7 100..153 CDD:290234 18/65 (28%)
EFh 100..153 CDD:298682 18/65 (28%)
EF-hand_7 184..241 CDD:290234 14/56 (25%)
EFh 184..241 CDD:298682 14/56 (25%)
EFh 228..281 CDD:298682 15/60 (25%)
CG31475NP_001262725.1 EF-hand_7 160..224 CDD:290234 19/63 (30%)
EF-hand_7 296..363 CDD:290234 15/66 (23%)
EFh 301..360 CDD:298682 14/58 (24%)
EFh 344..398 CDD:298682 16/53 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449115
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10827
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.