DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31650 and Scp2

DIOPT Version :9

Sequence 1:NP_001162879.1 Gene:CG31650 / 326150 FlyBaseID:FBgn0031673 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_524381.1 Gene:Scp2 / 42015 FlyBaseID:FBgn0020907 Length:184 Species:Drosophila melanogaster


Alignment Length:138 Identity:33/138 - (23%)
Similarity:59/138 - (42%) Gaps:36/138 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 DESKRRLLILIKM-MDLNKDEFIDRHELKAWI-----LRSFKK--LSEEEAADRFEEI------- 138
            |..|::||.|..: .|:|:...||..:.:..|     ||.::|  ...:|..|...||       
  Fly     5 DFRKKKLLFLFNVFFDVNQSGEIDVKDFELAIERVCQLRGWQKDTPKNKETYDLMMEIWTGLRSK 69

  Fly   139 -DQDADERITWKEY--LQDTYAMEDE---DFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGV 197
             |:|.|.:::..|:  :.|.||.:..   |::...:::               ||:..|.:.||.
  Fly    70 ADKDNDGQVSVDEWCNMWDAYAKDPSSVMDWQNAYMNF---------------MFDLEDASHDGG 119

  Fly   198 LTLEEFVL 205
            :.:.||.|
  Fly   120 IDVTEFTL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31650NP_001162879.1 EF-hand_7 100..153 CDD:290234 16/70 (23%)
EFh 100..153 CDD:298682 16/70 (23%)
EF-hand_7 184..241 CDD:290234 8/22 (36%)
EFh 184..241 CDD:298682 8/22 (36%)
EFh 228..281 CDD:298682
Scp2NP_524381.1 EFh 10..87 CDD:298682 19/76 (25%)
EF-hand_7 14..86 CDD:290234 17/71 (24%)
FRQ1 71..163 CDD:227455 16/72 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10827
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.