DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31650 and Scp2

DIOPT Version :10

Sequence 1:NP_608899.1 Gene:CG31650 / 326150 FlyBaseID:FBgn0031673 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_524381.1 Gene:Scp2 / 42015 FlyBaseID:FBgn0020907 Length:184 Species:Drosophila melanogaster


Alignment Length:138 Identity:33/138 - (23%)
Similarity:59/138 - (42%) Gaps:36/138 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 DESKRRLLILIKM-MDLNKDEFIDRHELKAWI-----LRSFKK--LSEEEAADRFEEI------- 138
            |..|::||.|..: .|:|:...||..:.:..|     ||.::|  ...:|..|...||       
  Fly     5 DFRKKKLLFLFNVFFDVNQSGEIDVKDFELAIERVCQLRGWQKDTPKNKETYDLMMEIWTGLRSK 69

  Fly   139 -DQDADERITWKEY--LQDTYAMEDE---DFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGV 197
             |:|.|.:::..|:  :.|.||.:..   |::...:::               ||:..|.:.||.
  Fly    70 ADKDNDGQVSVDEWCNMWDAYAKDPSSVMDWQNAYMNF---------------MFDLEDASHDGG 119

  Fly   198 LTLEEFVL 205
            :.:.||.|
  Fly   120 IDVTEFTL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31650NP_608899.1 EFh_CREC_RCN2_like 58..322 CDD:320025 33/138 (24%)
EF-hand motif 58..88 CDD:320025
EF-hand motif 94..123 CDD:320025 10/34 (29%)
EF-hand motif 130..159 CDD:320025 11/38 (29%)
EF-hand motif 182..211 CDD:320025 8/24 (33%)
EF-hand motif 219..248 CDD:320025
EF-hand motif 256..285 CDD:320025
EF-hand motif 292..322 CDD:320025
Scp2NP_524381.1 FRQ1 5..169 CDD:444056 33/138 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.