DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31650 and rcn3

DIOPT Version :9

Sequence 1:NP_001162879.1 Gene:CG31650 / 326150 FlyBaseID:FBgn0031673 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001002158.1 Gene:rcn3 / 415248 ZFINID:ZDB-GENE-040625-175 Length:316 Species:Danio rerio


Alignment Length:299 Identity:118/299 - (39%)
Similarity:171/299 - (57%) Gaps:13/299 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 IYAPRDAHHHGEDGEHNVEFDHEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRH 113
            |:...|...|..|..|..:|||||.:|. :|::.||.|||:|||.||..::..:|.:||.|:...
Zfish    26 IHHKLDLSDHAHDDAHGFQFDHEAFLGK-EESKTFDQLSPEESKDRLGKIVDKIDTDKDGFVSHA 89

  Fly   114 ELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAME-DEDFKKETIDYDSYEDEQ 177
            ||..||....::..||.....:.|.||:.|.:|.|.||...||... |.:|.    |.|.....:
Zfish    90 ELHHWIKHRQRRYIEENVDKHWNEYDQNKDGKIGWIEYKNTTYGYYIDTEFD----DVDDKATYK 150

  Fly   178 KMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVG 242
            .|:.:|:..|.:||.:.|||.|.|||..|.:|||...|..|:::.|::|.|.:.||||:.||::|
Zfish   151 SMLNRDERRFKSADRDGDGVATREEFTAFLHPEEFDFMRDIVIQETIEDIDKNGDGKIDLQEYIG 215

  Fly   243 DAASHHDKE----WLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDED 303
            |..:..|.|    |:.|||::|.:..|.|.||.|...||..||:|:....|::|..||...||:|
Zfish   216 DMYNPEDGETEPDWVTTEKKQFSEFRDMNKDGFLDATEVSHWILPTEVDHADNEARHLIHETDKD 280

  Fly   304 HDDRLSYLEILNNYDTFVGSEATDYGDHLQNINHLSDEL 342
            :||:::..|||.|::.||||:||:||:.|.. .|  |||
Zfish   281 NDDKITKKEILENWNMFVGSQATNYGEDLTK-RH--DEL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31650NP_001162879.1 EF-hand_7 100..153 CDD:290234 18/52 (35%)
EFh 100..153 CDD:298682 18/52 (35%)
EF-hand_7 184..241 CDD:290234 25/56 (45%)
EFh 184..241 CDD:298682 25/56 (45%)
EFh 228..281 CDD:298682 23/56 (41%)
rcn3NP_001002158.1 EF-hand_7 71..128 CDD:290234 18/56 (32%)
EFh 73..122 CDD:298682 14/48 (29%)
EF-hand_7 157..214 CDD:290234 25/56 (45%)
EFh 157..214 CDD:238008 25/56 (45%)
EFh 193..258 CDD:298682 25/64 (39%)
EFh 234..292 CDD:298682 23/57 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 54 1.000 Domainoid score I11312
eggNOG 1 0.900 - - E1_KOG4223
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D372250at33208
OrthoFinder 1 1.000 - - FOG0000638
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.