DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31650 and calua

DIOPT Version :9

Sequence 1:NP_001162879.1 Gene:CG31650 / 326150 FlyBaseID:FBgn0031673 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_001002151.2 Gene:calua / 415241 ZFINID:ZDB-GENE-040625-166 Length:317 Species:Danio rerio


Alignment Length:341 Identity:122/341 - (35%)
Similarity:191/341 - (56%) Gaps:31/341 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LPLLPLTLCAVALLAAVGPMPAHGAVANSHKHEKHLSKERVKDGIYAPRDAHHHGEDGEHNVEFD 69
            :.:.||.:|....:          ..|.|...||   |:||...  ||..:..| :||. |.|:|
Zfish     3 MEIRPLLMCFALCV----------VYATSKPTEK---KDRVHHD--APLSSKEH-DDGT-NFEYD 50

  Fly    70 HEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADR 134
            |:|.:|. :||:.||.|:|:|||.||..:::.:|.::|.|:...||||||.::.||...:....:
Zfish    51 HDAFLGE-EEAKTFDDLTPEESKNRLGKIVEKIDADEDGFVTEAELKAWIKKAQKKYIYDNVERQ 114

  Fly   135 FEEIDQDADERITWKEYLQDTYAMEDEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLT 199
            :::.|.:.|..|:|:||...||....:|.:.:    |.|..:| |:.:|:..|..||.|.|.:..
Zfish   115 WKDFDLNNDRMISWEEYKNVTYGTYLDDPEPD----DGYNYKQ-MMARDERRFKMADGNGDHIAD 174

  Fly   200 LEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGDAASHHDK----EWLITEKERF 260
            .|||..|.:|||:..|..|::..||:|.|.:.||.|:.:|::||..:|.|:    ||:.||:|:|
Zfish   175 KEEFTAFLHPEEYEHMKDIVVLETMEDIDKNGDGFIDLEEYIGDMYNHEDEMDEPEWVATEREQF 239

  Fly   261 DKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEA 325
            .:..|.|.||.:..:|.:.||:|::...|..|..||...:|.:.|.:|:..||||.||.||||:|
Zfish   240 SEFRDKNKDGKMDREETMDWILPADYDHAEAEAKHLVYESDTNKDGKLTKEEILNKYDLFVGSQA 304

  Fly   326 TDYGDHLQNINHLSDE 341
            ||:|:.|  :.|  ||
Zfish   305 TDFGEAL--VRH--DE 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31650NP_001162879.1 EF-hand_7 100..153 CDD:290234 17/52 (33%)
EFh 100..153 CDD:298682 17/52 (33%)
EF-hand_7 184..241 CDD:290234 22/56 (39%)
EFh 184..241 CDD:298682 22/56 (39%)
EFh 228..281 CDD:298682 20/56 (36%)
caluaNP_001002151.2 EF-hand_7 75..132 CDD:290234 17/56 (30%)
EF-hand_7 159..216 CDD:290234 22/56 (39%)
EFh 159..216 CDD:298682 22/56 (39%)
EFh 200..260 CDD:238008 21/59 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4223
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D372250at33208
OrthoFinder 1 1.000 - - FOG0000638
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.