DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31650 and rcn3

DIOPT Version :9

Sequence 1:NP_001162879.1 Gene:CG31650 / 326150 FlyBaseID:FBgn0031673 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_989389.1 Gene:rcn3 / 395023 XenbaseID:XB-GENE-5781886 Length:323 Species:Xenopus tropicalis


Alignment Length:338 Identity:112/338 - (33%)
Similarity:189/338 - (55%) Gaps:31/338 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RNLPL-LPLTLCAVALLAAVGPMPAHGAVANSHKHEKHLSKERVKDGIYAPRDAHHHGEDGEHNV 66
            |:||: |.:|||    ::.|..:|               :||: ||.::..:|...|..|.:...
 Frog     2 RSLPVFLLVTLC----VSWVMGVP---------------TKEK-KDRVHHSKDLSDHEHDDQKGF 46

  Fly    67 EFDHEAIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEA 131
            ::||||.:|. :||:.||.|:|:||:.||..:|..||.:.|::|...||.|||....::.:.|::
 Frog    47 QYDHEAFLGK-EEARTFDQLTPEESQHRLGKIIDQMDKDNDKYITSGELFAWIKHVSRRWNLEDS 110

  Fly   132 ADRFEEIDQDADERITWKEYLQDTYAM---EDEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTN 193
            ..:.::.|.:.|..|:|.||.:..|..   :.|:| .:..|.|. |..:||:.:|:..|..||.:
 Frog   111 EKQGKKYDTNKDGMISWDEYAKGVYGHLLGKGEEF-YDVADKDK-ERYRKMMMRDERRFKVADKD 173

  Fly   194 KDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGDAASHHDKE----WLI 254
            .|.:.|.|||..|.:|||:..|..|::..|::|.|.:.||.::..|::.|..:.::.|    |:.
 Frog   174 GDLIATREEFTAFLHPEEYGYMQDIVITETIEDIDKNDDGIVDVHEYIADMYTPNEDEPEPDWVK 238

  Fly   255 TEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDT 319
            ||:::|....|.|.||.:...|:..||:|.:...|:.|..||...:|:|.|.:|:..|||:|::.
 Frog   239 TERQQFTDFRDINKDGKMDRTEISQWILPHDYDHADLEAKHLVYESDKDKDGKLTKKEILDNWNM 303

  Fly   320 FVGSEATDYGDHL 332
            ||||:||:||:.|
 Frog   304 FVGSQATNYGEDL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31650NP_001162879.1 EF-hand_7 100..153 CDD:290234 16/52 (31%)
EFh 100..153 CDD:298682 16/52 (31%)
EF-hand_7 184..241 CDD:290234 20/56 (36%)
EFh 184..241 CDD:298682 20/56 (36%)
EFh 228..281 CDD:298682 15/56 (27%)
rcn3NP_989389.1 EFh_CREC_Calumenin_like 38..306 CDD:320024 90/270 (33%)
EF-hand motif 38..67 CDD:320024 12/29 (41%)
EF-hand motif 73..102 CDD:320024 12/28 (43%)
EF-hand motif 109..138 CDD:320024 7/28 (25%)
EF-hand motif 162..191 CDD:320024 11/28 (39%)
EF-hand motif 199..228 CDD:320024 7/28 (25%)
EF-hand motif 240..269 CDD:320024 10/28 (36%)
EF-hand motif 276..306 CDD:320024 12/29 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D372250at33208
OrthoFinder 1 1.000 - - FOG0000638
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.