DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31650 and Rcn1

DIOPT Version :9

Sequence 1:NP_001162879.1 Gene:CG31650 / 326150 FlyBaseID:FBgn0031673 Length:342 Species:Drosophila melanogaster
Sequence 2:NP_033063.1 Gene:Rcn1 / 19672 MGIID:104559 Length:325 Species:Mus musculus


Alignment Length:338 Identity:116/338 - (34%)
Similarity:186/338 - (55%) Gaps:37/338 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VALLAAVGPMPAHGAVANSHKHEKHLSKERVKDGIYAPRDAHHHGE---DGEHNVEFDHEAIIGN 76
            :||:.|:...|.             :.||||      .|.....||   :...:.::||||.:|.
Mouse    15 LALVLALRAKPT-------------VRKERV------VRPDSELGERPPEDNQSFQYDHEAFLGK 60

  Fly    77 TKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADRFEEIDQD 141
             ::::.||.|||||||.||..::..:|.:.|..:...|||.||.|..|:...:..|..:::.|:|
Mouse    61 -EDSKTFDQLSPDESKERLGKIVDRIDSDGDGLVTTEELKLWIKRVQKRYIYDNVAKVWKDYDRD 124

  Fly   142 ADERITWKEYLQDTYAM---EDEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLTLEEF 203
            .||:|:|:||.|.||..   ...:| .::.|:.::   :||:.:|:..|.|:|.:.|...|.|||
Mouse   125 KDEKISWEEYKQATYGYYLGNPAEF-HDSSDHHTF---KKMLPRDERRFKASDLDGDLTATREEF 185

  Fly   204 VLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGDAASHHDK----EWLITEKERFDKDH 264
            ..|.:|||...|..|::..|::|.|.:.||.::..|::.|..||.|.    :|:::|:|:|:...
Mouse   186 TAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEDNGPEPDWVLSEREQFNDFR 250

  Fly   265 DSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATDYG 329
            |.|.||.|..||:..||:|.:...|..|..||...:|::.|:.|:..|||:|::.||||:||:||
Mouse   251 DLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEMLTKEEILDNWNMFVGSQATNYG 315

  Fly   330 DHLQNINHLSDEL 342
            :.|.. ||  |||
Mouse   316 EDLTK-NH--DEL 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31650NP_001162879.1 EF-hand_7 100..153 CDD:290234 18/52 (35%)
EFh 100..153 CDD:298682 18/52 (35%)
EF-hand_7 184..241 CDD:290234 20/56 (36%)
EFh 184..241 CDD:298682 20/56 (36%)
EFh 228..281 CDD:298682 19/56 (34%)
Rcn1NP_033063.1 FRQ1 62..232 CDD:227455 60/173 (35%)
EFh 80..137 CDD:298682 18/56 (32%)
EFh 166..224 CDD:298682 20/57 (35%)
EFh 204..267 CDD:238008 21/62 (34%)
Prevents secretion from ER 322..325 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4223
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000638
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.