DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CDC50 and tmem30b

DIOPT Version :9

Sequence 1:NP_573128.2 Gene:CDC50 / 32615 FlyBaseID:FBgn0030752 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001039177.1 Gene:tmem30b / 734012 XenbaseID:XB-GENE-5741064 Length:353 Species:Xenopus tropicalis


Alignment Length:349 Identity:160/349 - (45%)
Similarity:212/349 - (60%) Gaps:36/349 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SKRPSDSAFKQQRLPAWQPVLTARTVLPTFFVIGVLFIPIGVVLLHLSNTANELIIDYT------ 74
            |:||.::||.|||||||||:|:|..|:|.||..|:.||.||:.|.:.||:..|...|||      
 Frog    16 SQRPDNTAFTQQRLPAWQPLLSASIVIPFFFFAGLSFIAIGLGLYYSSNSIKESEFDYTGAVLGD 80

  Fly    75 ---KCRRSGGNTTCAEYLEANPGVTCPCEVPFVLPSDFNGVVYMYYGLTNYYQNHRRYVKSRDDE 136
               .||              |....|.|.|||.:...|.|.|.|||.|:||||||.||:.|.|.:
 Frog    81 YCYNCR--------------NESRGCTCNVPFNITEFFQGPVCMYYELSNYYQNHYRYMISVDPK 131

  Fly   137 QLLGHLS--QTPSTDCAPFAYDPDSGKPIAPCGAIANSLFNDTLTL--LQGGS--EIKLLKTGIA 195
            ||.|.:.  :.||..|:|:.:| ....|||||||:|||:|||.::|  ...|:  |:.|.:.||:
 Frog   132 QLGGLIDNLKAPSNYCSPYQWD-SKNLPIAPCGAVANSMFNDVISLHYKDNGTYVEVPLTRKGIS 195

  Fly   196 WPSDKRVKFRNP-EGNLNVS--LEGFSKPIFWQKGLADLDPENPDNNGFQNEDLIVWMRTAALPS 257
            |.||..|||:|| .||..::  ..|.:||..|.....:|. ::|.|.||.|||.|||||.|||||
 Frog   196 WWSDYNVKFQNPTNGNETLAQVFNGTAKPSNWLTPAYNLS-DDPSNTGFINEDFIVWMRRAALPS 259

  Fly   258 FRKLYRRLNQTNTNYANGLKSGNYTLNIKYNYPVVSFDGTKRMILSTTSVLGGKNPFLGIAYIVV 322
            |||||||:.  :.|:..||..|.|.|.|.|||||:||||.|:::.|:.|.:|||||||||||:|.
 Frog   260 FRKLYRRIE--SGNFTTGLPPGEYLLKIVYNYPVLSFDGRKKIVFSSLSWMGGKNPFLGIAYLVF 322

  Fly   323 GAICITLGLALLFIHMRCSRSNME 346
            |::|....:.:|.|.::.|:.:.|
 Frog   323 GSLCTLFAIVILIIFLKTSQKDDE 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CDC50NP_573128.2 CDC50 67..340 CDD:281387 130/290 (45%)
tmem30bNP_001039177.1 CDC50 59..339 CDD:367471 133/297 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53602
OrthoDB 1 1.010 - - D461644at33208
OrthoFinder 1 1.000 - - FOG0000577
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10926
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X371
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.