DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31642 and Rnf166

DIOPT Version :9

Sequence 1:NP_723159.1 Gene:CG31642 / 326149 FlyBaseID:FBgn0051642 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001028314.1 Gene:Rnf166 / 68718 MGIID:1915968 Length:237 Species:Mus musculus


Alignment Length:170 Identity:33/170 - (19%)
Similarity:46/170 - (27%) Gaps:66/170 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 QMRNPPERHFGHRCENCKISDFQGRRYTCRFCAE------------YTLCGKCFD---ANHLPAS 53
            |.|.||....|..      |..:. :::|..|.|            :|.||:|..   ....|..
Mouse    12 QQRQPPAGPAGGD------SGLEA-QFSCPICLEVYHRPVAIGSCGHTFCGECLQPCLQVPSPLC 69

  Fly    54 PQHRY-YHPMSVYYA-YAEYQLYFGGEPFCGDHKVA----------------------------- 87
            |..|. :.|..|..| :.|.||.....|..|.:|..                             
Mouse    70 PLCRLPFDPKKVDKATHVEKQLSSYKAPCRGCNKKVTLAKMRAHISSCLKVQEQMANCPKFVPVV 134

  Fly    88 -------------QSYKCALCDVRGLSTAHLFMHLLQEHR 114
                         .::.|..|..|.|....|..|.::.||
Mouse   135 PTSQPIPSNIPNRSTFACPYCGARNLDQQELVKHCVESHR 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31642NP_723159.1 ZZ_PCMF_like 15..65 CDD:239078 12/65 (18%)
Rnf166NP_001028314.1 RING-HC_RNF166 30..76 CDD:319463 10/45 (22%)
zf_C2HC_14 92..124 CDD:408358 3/31 (10%)
zf-Di19 149..208 CDD:398954 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.