DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31642 and stmn1a

DIOPT Version :9

Sequence 1:NP_723159.1 Gene:CG31642 / 326149 FlyBaseID:FBgn0051642 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001035465.1 Gene:stmn1a / 678630 ZFINID:ZDB-GENE-031006-14 Length:148 Species:Danio rerio


Alignment Length:69 Identity:18/69 - (26%)
Similarity:32/69 - (46%) Gaps:4/69 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 TAESKATELPSASTSSAYFTVLGDIPYADSGSDDLESNASEEMASDLHGEGNSDDLAGLEEDKES 521
            |::.:..||...::..|:..:||. |.:|..::.|.|...::   ||........|...||.::|
Zfish     4 TSDIQVKELDKRASGQAFEVILGS-PASDVKNEFLLSPPKKK---DLSLVEIQKKLEAAEERRKS 64

  Fly   522 GEEE 525
            .|.|
Zfish    65 HEAE 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31642NP_723159.1 ZZ_PCMF_like 15..65 CDD:239078
stmn1aNP_001035465.1 Stathmin 6..141 CDD:307125 17/67 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.