powered by:
Protein Alignment CG31642 and stmn1a
DIOPT Version :9
Sequence 1: | NP_723159.1 |
Gene: | CG31642 / 326149 |
FlyBaseID: | FBgn0051642 |
Length: | 557 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001035465.1 |
Gene: | stmn1a / 678630 |
ZFINID: | ZDB-GENE-031006-14 |
Length: | 148 |
Species: | Danio rerio |
Alignment Length: | 69 |
Identity: | 18/69 - (26%) |
Similarity: | 32/69 - (46%) |
Gaps: | 4/69 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 457 TAESKATELPSASTSSAYFTVLGDIPYADSGSDDLESNASEEMASDLHGEGNSDDLAGLEEDKES 521
|::.:..||...::..|:..:||. |.:|..::.|.|...:: ||........|...||.::|
Zfish 4 TSDIQVKELDKRASGQAFEVILGS-PASDVKNEFLLSPPKKK---DLSLVEIQKKLEAAEERRKS 64
Fly 522 GEEE 525
.|.|
Zfish 65 HEAE 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG31642 | NP_723159.1 |
ZZ_PCMF_like |
15..65 |
CDD:239078 |
|
stmn1a | NP_001035465.1 |
Stathmin |
6..141 |
CDD:307125 |
17/67 (25%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG1280 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.