Sequence 1: | NP_723159.1 | Gene: | CG31642 / 326149 | FlyBaseID: | FBgn0051642 | Length: | 557 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001297451.1 | Gene: | Stmn4 / 56471 | MGIID: | 1931224 | Length: | 216 | Species: | Mus musculus |
Alignment Length: | 216 | Identity: | 37/216 - (17%) |
---|---|---|---|
Similarity: | 75/216 - (34%) | Gaps: | 60/216 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 347 STVITSPLKDKRF----LCSKLVSGNGQK-------WESKLLKATFTEAMFCSMLADEELFQPPI 400
Fly 401 GLPWTANFMLDAVEPSGSVKSNGKLLLYPVKTKELMERFYRGLAEYKTWIGYQTEPTAESKATEL 465
Fly 466 PSASTSSAY-----FTVLGD--------IPYADSGSDDLESNASEEMASDLHGEGNSDD----LA 513
Fly 514 GL-----EEDKESGEEENGDE 529 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG31642 | NP_723159.1 | ZZ_PCMF_like | 15..65 | CDD:239078 | |
Stmn4 | NP_001297451.1 | Stathmin | 76..211 | CDD:395674 | 28/160 (18%) |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1280 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |