DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31642 and RNF114

DIOPT Version :9

Sequence 1:NP_723159.1 Gene:CG31642 / 326149 FlyBaseID:FBgn0051642 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_061153.1 Gene:RNF114 / 55905 HGNCID:13094 Length:228 Species:Homo sapiens


Alignment Length:133 Identity:29/133 - (21%)
Similarity:45/133 - (33%) Gaps:51/133 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 KAQTKTQGDQPTKKVSTVITSP---LKDKRFLCSKLVSGNGQKWESKLLKATFTEAMFCSMLADE 393
            ||..|....|| :.|....|.|   ..:|.|....||.      ..||..:|.|:::.|.:.|  
Human   122 KATIKDASLQP-RNVPNRYTFPCPYCPEKNFDQEGLVE------HCKLFHSTDTKSVVCPICA-- 177

  Fly   394 ELFQPPIGLPW------TANFMLDAVEPSGSVKSNGKLLLYPVKTKELMERFYRGLAEYKTWIGY 452
                   .:||      :|||                        :|.::|.:|  ..|.|::.|
Human   178 -------SMPWGDPNYRSANF------------------------REHIQRRHR--FSYDTFVDY 209

  Fly   453 QTE 455
            ..:
Human   210 DVD 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31642NP_723159.1 ZZ_PCMF_like 15..65 CDD:239078
RNF114NP_061153.1 RING-HC_RNF114 27..68 CDD:319454
RING-HC finger (C3HC4-type) 29..67 CDD:319454
zf-Di19 140..200 CDD:310299 19/98 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.