DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG31642 and RNF114

DIOPT Version :9

Sequence 1:	NP_723159.1	Gene:	CG31642 / 326149	FlyBaseID:	FBgn0051642	Length:	557	Species:	Drosophila melanogaster
Sequence 2:	NP_061153.1	Gene:	RNF114 / 55905	HGNCID:	13094	Length:	228	Species:	Homo sapiens

Alignment Length:	133	Identity:	29/133 - (21%)
Similarity:	45/133 - (33%)	Gaps:	51/133 - (38%)

- Green bases have known domain annotations that are detailed below.

  Fly   332 KAQTKTQGDQPTKKVSTVITSP---LKDKRFLCSKLVSGNGQKWESKLLKATFTEAMFCSMLADE 393
            ||..|....|| :.|....|.|   ..:|.|....||.      ..||..:|.|:::.|.:.|
Human   122 KATIKDASLQP-RNVPNRYTFPCPYCPEKNFDQEGLVE------HCKLFHSTDTKSVVCPICA-- 177

  Fly   394 ELFQPPIGLPW------TANFMLDAVEPSGSVKSNGKLLLYPVKTKELMERFYRGLAEYKTWIGY 452
                   .:||      :|||                        :|.::|.:|  ..|.|::.|
Human   178 -------SMPWGDPNYRSANF------------------------REHIQRRHR--FSYDTFVDY 209

  Fly   453 QTE 455
            ..:
Human   210 DVD 212

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG31642	NP_723159.1	ZZ_PCMF_like	15..65	CDD:239078
RNF114	NP_061153.1	RING-HC_RNF114	27..68	CDD:319454
		RING-HC finger (C3HC4-type)	29..67	CDD:319454
		zf-Di19	140..200	CDD:310299	19/98 (19%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910