DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31642 and stmn2a

DIOPT Version :9

Sequence 1:NP_723159.1 Gene:CG31642 / 326149 FlyBaseID:FBgn0051642 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001005923.2 Gene:stmn2a / 449651 ZFINID:ZDB-GENE-041010-85 Length:180 Species:Danio rerio


Alignment Length:149 Identity:34/149 - (22%)
Similarity:58/149 - (38%) Gaps:33/149 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 SSQTRSTRSRNLA------SVRPVAGGNTRSEQRTEQVF--------DSALSLA----LMVVQLD 192
            |.|||:    |:.      .|:|:   |.|:..:..:|.        |:|.|:.    ...:.||
Zfish    26 SPQTRN----NIVCEFEDMEVKPI---NKRASGQAFEVILKPPSPVSDAAHSITSPPKKRDMSLD 83

  Fly   193 NMDS--TAADFPERCYE--ILQQTETVLMQHRSSRVPDMEAIESFVRVIEDQVVTSM----ADRR 249
            ::..  .||:...|..|  :|:.........|...:..||...:|.::.|::::..|    .:|.
Zfish    84 DIQKKLEAAEDRRRSQEAQVLKALAEKREHERDVLLKAMEENSNFSKMAEEKLILKMEQNKENRE 148

  Fly   250 QRLGASSSSLHRLTRIEAI 268
            ..|.|....||...|..||
Zfish   149 AHLAAMIDRLHEKERHAAI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31642NP_723159.1 ZZ_PCMF_like 15..65 CDD:239078
stmn2aNP_001005923.2 Stathmin 43..174 CDD:279209 28/128 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.