DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31642 and stmn4

DIOPT Version :9

Sequence 1:NP_723159.1 Gene:CG31642 / 326149 FlyBaseID:FBgn0051642 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_998566.1 Gene:stmn4 / 406710 ZFINID:ZDB-GENE-040426-2732 Length:188 Species:Danio rerio


Alignment Length:100 Identity:18/100 - (18%)
Similarity:43/100 - (43%) Gaps:20/100 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 NTRSEQRTEQVFDSALSL------ALMVVQLDNMDSTAA---DFPERCYEILQQTETVLMQHRSS 222
            :.|:|..|.:..| |:.|      .:.|::|:...|..|   ......:::..:..|.:.|.:. 
Zfish    25 SNRAENPTYKAED-AVDLNWCVIKEMEVIELNKRTSGQAFEVILKPPSFDVAPELNTSIPQRKD- 87

  Fly   223 RVPDMEAIESFVRVIED-------QVVTSMADRRQ 250
              |.:|.|:..:...|:       :::..:|::|:
Zfish    88 --PSLEEIQKKLEAAEERRKFQEAEMLKHLAEKRE 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31642NP_723159.1 ZZ_PCMF_like 15..65 CDD:239078
stmn4NP_998566.1 Stathmin 52..182 CDD:279209 11/71 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.