DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31642 and STMN1

DIOPT Version :9

Sequence 1:NP_723159.1 Gene:CG31642 / 326149 FlyBaseID:FBgn0051642 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001138926.1 Gene:STMN1 / 3925 HGNCID:6510 Length:174 Species:Homo sapiens


Alignment Length:97 Identity:19/97 - (19%)
Similarity:38/97 - (39%) Gaps:27/97 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 VLMQHRSSRVPDMEAIE-------SFVRVIEDQVVTSM-ADRRQRLGASSSSLHRLTR---IEAI 268
            ||.|....|..:.|.::       :|.::.|:::...| |::..|....::.|.||..   ....
Human    68 VLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKMYFWTH 132

  Fly   269 SPGTNTAL----------------AMGMRAAM 284
            .||.:.|.                |:|:::|:
Human   133 GPGAHPAQISAEQSCLHSVPALCPALGLQSAL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31642NP_723159.1 ZZ_PCMF_like 15..65 CDD:239078
STMN1NP_001138926.1 Stathmin 9..126 CDD:279209 13/57 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.