DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31642 and stai

DIOPT Version :9

Sequence 1:NP_723159.1 Gene:CG31642 / 326149 FlyBaseID:FBgn0051642 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_001245912.1 Gene:stai / 33863 FlyBaseID:FBgn0266521 Length:381 Species:Drosophila melanogaster


Alignment Length:395 Identity:84/395 - (21%)
Similarity:143/395 - (36%) Gaps:92/395 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RCENC-KI-SDFQGRRYTCRFC-AEYTLCGKCFDANHLPASPQHRYYHPMSVYYAYAEYQLYFGG 77
            :|:.| :| :||. |||.|..| :|...||:|||......:..|:....:.:.|..:....:|.|
  Fly    11 KCKGCGQIRADFD-RRYGCSECGSEVMYCGQCFDEGRNQHTETHKDDRRIKIIYHRSFLDKFFSG 74

  Fly    78 EPFC-GDHKVAQSYKCALCDVRGLSTAHLFMHLLQEHRDHRDHDAYLSLVNTLYIAD-------- 133
            |... ||  .::||.|..|..| .|...|.:||.:.|.:..|..|...::..:...|        
  Fly    75 EKLLNGD--ASKSYNCVFCKKR-FSAEELQLHLSEMHSNPADASALTVMLERMRQEDLENRIATE 136

  Fly   134 --------NGMEQQVPVPQPSSQTRSTRSRNLASVRPVAGGNTRSEQRTEQVFDSA----LSL-- 184
                    .|:..:|.:.:|:......:       |||..|...|.:..||...:|    :||  
  Fly   137 IRCQEKSRGGLSYEVILAEPAPNVAVPK-------RPVTPGKNVSVEEIEQKLKAAEERRISLEA 194

  Fly   185 ---ALMVVQLDNMDSTAADFPERCYEILQQTETVLMQHRSSRVPDMEAIESFVRVIEDQVVTSMA 246
               |.:..:|..::.......|...|.:.||:..|.......|...|||              ::
  Fly   195 KKMADISTKLAKVEEATRKKDEITNEFITQTKEQLESKMELHVEKREAI--------------IS 245

  Fly   247 DRRQRLGASSSSLHRLTR--IEAISPGTNTALAMGMRAAMPVLVDQPTTMVRRQTARRTGEPIGI 309
            |.:::|...:..:.: ||  :|........|:...::.|..:..:....|:.|.....|      
  Fly   246 DMKEKLKIHAQDIEK-TRETLEQQKANEQKAIEEKLKIAQSLRDENIKKMLDRLKEHNT------ 303

  Fly   310 ALQSAVASSSRSGKAGSSSGVAKAQTKTQGDQ-PTKKVSTVITSPLKDKRFLCSKLVSGNGQKWE 373
                                :..|:.|:|.|| ..:|:.       :..|...:||.:.. ||.|
  Fly   304 --------------------IKIAEIKSQNDQLECQKIE-------EKARIYENKLFAAE-QKRE 340

  Fly   374 SKLLK 378
            .:|.|
  Fly   341 KELQK 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31642NP_723159.1 ZZ_PCMF_like 15..65 CDD:239078 17/51 (33%)
staiNP_001245912.1 Stathmin 138..267 CDD:279209 28/150 (19%)
beta_CA <242..313 CDD:294276 14/111 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.