DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31642 and Stmn1

DIOPT Version :9

Sequence 1:NP_723159.1 Gene:CG31642 / 326149 FlyBaseID:FBgn0051642 Length:557 Species:Drosophila melanogaster
Sequence 2:NP_062615.1 Gene:Stmn1 / 16765 MGIID:96739 Length:149 Species:Mus musculus


Alignment Length:104 Identity:21/104 - (20%)
Similarity:43/104 - (41%) Gaps:17/104 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   457 TAESKATELPSASTSSAYFTVLG--------DIPYADSGSDDL---ESNASEEMASDLHGEGNSD 510
            :::.:..||...::..|:..:|.        |.|.:.....||   |.....|.|.:......::
Mouse     3 SSDIQVKELEKRASGQAFELILSPRSKESVPDFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAE 67

  Fly   511 DLAGLEEDKESGEE--ENGDEDDGASDSDFSESAISQIT 547
            .|..|.|.:|..:|  :...|:    :::||:.|..::|
Mouse    68 VLKQLAEKREHEKEVLQKAIEE----NNNFSKMAEEKLT 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31642NP_723159.1 ZZ_PCMF_like 15..65 CDD:239078
Stmn1NP_062615.1 Stathmin 5..140 CDD:395674 21/102 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 3/18 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 104..149
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1280
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.