DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and ELO1

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_012339.1 Gene:ELO1 / 853243 SGDID:S000003732 Length:310 Species:Saccharomyces cerevisiae


Alignment Length:280 Identity:76/280 - (27%)
Similarity:123/280 - (43%) Gaps:66/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LSSPLPTLCMCIFYA-YFSKSLGPRLMAKR-KPMELRSVLVVYNAIQTIFS-AW--IFYEYLMSG 89
            ||.|.|.|   :|.| |:....|.|.:.|. ||::||.:..|:|.:.|..| .|  :..|.::  
Yeast    59 LSEPRPVL---LFIAMYYVVIFGGRSLVKSCKPLKLRFISQVHNLMLTSVSFLWLILMVEQML-- 118

  Fly    90 WWGHYSLKCQPVDYSTTGLAMRMVNICWW-------YYI---SKFTEFFDTLFFILRKKNEHVST 144
                      |:.| ..||...:.|:..|       ||:   :||.||.||:..:|  |:..::.
Yeast   119 ----------PIVY-RHGLYFAVCNVESWTQPMETLYYLNYMTKFVEFADTVLMVL--KHRKLTF 170

  Fly   145 LHVIHHG-----CMPFSV-WMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWK 203
            ||..|||     |....| :..:.:.|       ..||..||::||:||.::|.|.:    :|||
Yeast   171 LHTYHHGATALLCYNQLVGYTAVTWVP-------VTLNLAVHVLMYWYYFLSASGIR----VWWK 224

  Fly   204 KYLTTFQMVQFVAIFTHQFQLLFR-------------ECDYPKGFMVWIGLHGVM---FLFLFSD 252
            .::|..|:|||:......:.:|::             :|:...|.|..|.....:   :||||..
Yeast   225 AWVTRLQIVQFMLDLIVVYYVLYQKIVAAYFKNACTPQCEDCLGSMTAIAAGAAILTSYLFLFIS 289

  Fly   253 FYKAKYLNAARRRRQAVKAN 272
            ||...|...:...::.:..|
Yeast   290 FYIEVYKRGSASGKKKINKN 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 75/271 (28%)
ELO1NP_012339.1 ELO 58..303 CDD:395916 75/272 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 99 1.000 Domainoid score I1570
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9158
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
76.760

Return to query results.
Submit another query.