DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and Elovl4

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_683743.2 Gene:Elovl4 / 83603 MGIID:1933331 Length:312 Species:Mus musculus


Alignment Length:306 Identity:119/306 - (38%)
Similarity:169/306 - (55%) Gaps:30/306 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SDPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFSAWIFYE 84
            :|.||.|:.|:.||.||:.:...|..| ..|||:.|..|:|.::|.||::||....:.:.:||.|
Mouse    33 ADKRVADWPLMQSPWPTISISTLYLLF-VWLGPKWMKDREPFQMRLVLIIYNFGMVLLNLFIFRE 96

  Fly    85 YLMSGWWGHYSLKCQPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILRKKNEHVSTLHVIH 149
            ..|..:...||..||.||||.....:|:....|||::||..|:.||:||||||||..||.|||.|
Mouse    97 LFMGSYNAGYSYICQSVDYSNDVNEVRIAGALWWYFVSKGVEYLDTVFFILRKKNNQVSFLHVYH 161

  Fly   150 HGCMPFSV-WMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLTTFQMVQ 213
            | |..|:: |:|:|:..||.:.|.|.:|||:|::||.||.:.|.||..|||:|||:|||..|:||
Mouse   162 H-CTMFTLWWIGIKWVAGGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTMLQLVQ 225

  Fly   214 FVAIFTHQFQLLFRECDYPKGFMVW-IGLHGVMFLFLFSDFYKAKYLNAARRRRQAVKANGYANG 277
            |.....|....|:.:|.:|| :|.| :..:.:.|:|||.:||...|    ...:|:.......||
Mouse   226 FHVTIGHTALSLYTDCPFPK-WMHWALIAYAISFIFLFLNFYTRTY----NEPKQSKTGKTATNG 285

  Fly   278 SASNGHSKHLGEGDALIANGCNTGACMPVMEDEYVKSKGQSNGAYK 323
            .:|||.:|    .:..:.||                 |.|.||..|
Mouse   286 ISSNGVNK----SEKALENG-----------------KPQKNGKPK 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 101/238 (42%)
Elovl4NP_683743.2 ELO 41..277 CDD:279492 102/242 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..312 14/59 (24%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204, ECO:0000269|PubMed:24569140 308..312 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.