DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and HOS3-1

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001329164.1 Gene:HOS3-1 / 829836 AraportID:AT4G36830 Length:308 Species:Arabidopsis thaliana


Alignment Length:279 Identity:60/279 - (21%)
Similarity:102/279 - (36%) Gaps:67/279 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YAYFSKSLGPRLMAKR---KPMELRSVLVVYNAIQTIFSAWIFYEYLMSG--------WWGHYS- 95
            |...|.||...|.|.|   :.:.|..:..:::.:.:|.||.||...|:|.        |....| 
plant    44 YIAVSSSLHILLSAVRRSNRSVPLGHIPEIHSLLMSILSATIFAGILLSAAAEIRDTRWLWRRSK 108

  Fly    96 -------LKCQPVDYSTTGLAMRMVNICWW---YYISKFTEFFDTLFFILRKKNEHVSTLHVIHH 150
                   |.|.|:....:|      .:.:|   :|:::|...|.|:|.:||.:...||.|..  :
plant   109 TATPLQWLLCFPLGTRPSG------RVFFWSYVFYLTRFLHMFRTIFAVLRSRRLAVSQLFC--N 165

  Fly   151 GCMPFSVWMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMG------PKYQKYIWWKKYLTTF 209
            ..|.|:.::.|:|:. .:.....|..:.|:.|:|.|......|      |.:  .:..:..|...
plant   166 SVMAFTSFLWLEFSQ-SYQILAILSTTLVYSVVYGYRFWTGFGLPGSAFPSF--VVNCQLVLVGC 227

  Fly   210 QMVQFVAIFT-HQFQLLFRECDYPKGFMVW---------------------IGLHGVMFLFLFSD 252
            .:|....:.| |.|:   ..|:   |...|                     .||||..:..:...
plant   228 NLVSHAGVLTMHLFK---GGCN---GIGAWGLNSVLNDIPQYPPKCGDRGNKGLHGGSWTRMIKS 286

  Fly   253 FYKAKYLNAARRRRQAVKA 271
            .|.....||...|.:.:|:
plant   287 LYSLPSENAFWIRGKIIKS 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 58/271 (21%)
HOS3-1NP_001329164.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.