DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and AT3G06470

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_187298.1 Gene:AT3G06470 / 819824 AraportID:AT3G06470 Length:278 Species:Arabidopsis thaliana


Alignment Length:258 Identity:77/258 - (29%)
Similarity:112/258 - (43%) Gaps:55/258 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 FLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFSAWIFYEYLMSGWWG 92
            |||.|.:.:|          .||.||:        |:.:..|::.|..:.|..:.....:|....
plant    48 FLLRSAIDSL----------PSLSPRI--------LKPITAVHSLILCLLSLVMAVGCTLSITSS 94

  Fly    93 HYSLK---------CQPVDYSTTGLAMRMVNICWW---YYISKFTEFFDTLFFILRKKNEHVSTL 145
            |.|..         |.|||....|      .:.:|   :|:||..||.||:..||.|..:.:|.|
plant    95 HASSDPMARFLHAICFPVDVKPNG------PLFFWAQVFYLSKILEFGDTILIILGKSIQRLSFL 153

  Fly   146 HVIHHGCMPFSVWMGLKFAPGGHSTF-FALL-NSFVHIVMYFYYMIAAMG--PKYQKYIWWKKYL 206
            ||.||..:....::.|:..   .|.| .||: ||.||::||.||.:.|:|  ||      ||:.:
plant   154 HVYHHATVVVMCYLWLRTR---QSMFPIALVTNSTVHVIMYGYYFLCAVGSRPK------WKRLV 209

  Fly   207 TTFQMVQFVAIFTHQFQLLFRECDYPKGFM-VWIGLHGVMF----LFLFSDFYKAKYLNAARR 264
            |..|:||||..|.....:| ||..:..|.. :|.......|    |.|||:|:...|:....|
plant   210 TDCQIVQFVFSFGLSGWML-REHLFGSGCTGIWGWCFNAAFNASLLALFSNFHSKNYVKKPTR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 77/258 (30%)
AT3G06470NP_187298.1 ELO 43..272 CDD:395916 77/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3313
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.