DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and AT3G06460

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_187297.1 Gene:AT3G06460 / 819823 AraportID:AT3G06460 Length:298 Species:Arabidopsis thaliana


Alignment Length:230 Identity:66/230 - (28%)
Similarity:99/230 - (43%) Gaps:45/230 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SLGPRLMAKRKPMELRSVLVVYNAIQTIFSAWIFYEYLMSGWWGH------YSLKCQPVDYSTTG 107
            :||||:        |:.:..|::.|..:.|..:.....:|.....      :...|.|:|....|
plant    59 TLGPRI--------LKPITAVHSLILFLLSLTMAVGCTLSLISSSDPKARLFDAVCFPLDVKPKG 115

  Fly   108 LAMRMVNICWW---YYISKFTEFFDTLFFILRKKNEHVSTLHVIHHGCMPFSVWMGLK----FAP 165
                  .:.:|   :|:||..||.|||..||.|..:.:|.|||.||..:....::.|:    ..|
plant   116 ------PLFFWAQVFYLSKILEFVDTLLIILNKSIQRLSFLHVYHHATVVILCYLWLRTRQSMFP 174

  Fly   166 GGHSTFFALLNSFVHIVMYFYYMIAAMG--PKYQKYIWWKKYLTTFQMVQFVAIFTHQFQLLFRE 228
            .|     .:|||.||::||.||.:.|:|  ||      |||.:|.||||||..........:..|
plant   175 VG-----LVLNSTVHVIMYGYYFLCAIGSRPK------WKKLVTNFQMVQFAFGMGLGAAWMLPE 228

  Fly   229 CDYPKGFM-VWI----GLHGVMFLFLFSDFYKAKY 258
            ..:..|.. :|.    |:.....|.||.:|:...|
plant   229 HYFGSGCAGIWTVYFNGVFTASLLALFYNFHSKNY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 66/230 (29%)
AT3G06460NP_187297.1 ELO 28..270 CDD:395916 66/230 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.