DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and Elovl5

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_030100414.1 Gene:Elovl5 / 68801 MGIID:1916051 Length:340 Species:Mus musculus


Alignment Length:268 Identity:106/268 - (39%)
Similarity:152/268 - (56%) Gaps:10/268 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFSAWIFYEY 85
            |.||..:|||.:.:||....:.|... ..|||:.|..|:|...|.:|.:||...|:.|.::|||.
Mouse    61 DTRVKGWFLLDNYIPTFVCSVIYLLI-VWLGPKYMKNRQPFSCRGILQLYNLGLTLLSLYMFYEL 124

  Fly    86 LMSGWWGHYSLKCQPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILRKKNEHVSTLHVIHH 150
            :...|.|.|:..||.. .|.....|:::.:.||||.||..||.||.||||||.|..::.|||.||
Mouse   125 VTGVWEGKYNFFCQGT-RSAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHH 188

  Fly   151 GCMPFSVWMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLTTFQMVQFV 215
            ..|....|..:.:.|.|||.|.|.||||:|::||.||.:::: |..:.|:|||||:|..|:||||
Mouse   189 ATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSI-PSMRPYLWWKKYITQGQLVQFV 252

  Fly   216 AIFTHQFQLLFRECDYPKGFMVW-IGLHGVMFLFLFSDFYKAKY-LNAARRRRQAVKANGYANGS 278
            .........:|..|.:|.|::.: || :.:..:.||::||...| ...|.||:..:|  |:.|||
Mouse   253 LTIIQTTCGVFWPCSFPLGWLFFQIG-YMISLIALFTNFYIQTYNKKGASRRKDHLK--GHQNGS 314

  Fly   279 --ASNGHS 284
              |.|||:
Mouse   315 VAAVNGHT 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 92/238 (39%)
Elovl5XP_030100414.1 ELO 68..302 CDD:366492 92/237 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.