DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and elovl6

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001017257.2 Gene:elovl6 / 550011 XenbaseID:XB-GENE-942876 Length:265 Species:Xenopus tropicalis


Alignment Length:287 Identity:75/287 - (26%)
Similarity:118/287 - (41%) Gaps:68/287 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EAQKWYRDLMDN--KSDPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVV 69
            ||.:|   :.:|  ||       ||.|:         .||.|... |..||.:|:..|||..|::
 Frog    21 EAIQW---MQENWKKS-------FLFSA---------LYAAFIFG-GRHLMKQREKFELRKPLIL 65

  Fly    70 YNAIQTIFSAWIFYEYLMSGWWGHYSLKCQPVDYSTTGLAMRMVNIC-----------WWYY--- 120
            ::....:||   .:..:.:|.:..|.|       .|.||..   ::|           :|.|   
 Frog    66 WSLSLAVFS---IFGAVRTGAYMLYIL-------MTKGLKQ---SVCDQSFYYGPVSKFWAYAFV 117

  Fly   121 ISKFTEFFDTLFFILRKKNEHVSTLHVIHHGCMPFSVWMGLK--FAPGGHSTFFALLNSFVHIVM 183
            :||..|..||:|.||||  :.:..||..||..:....|...|  .|.||   :|..:|..||.||
 Frog   118 LSKAPELGDTIFIILRK--QKLIFLHWYHHITVLLYSWYSYKDMVAGGG---WFMTMNYGVHAVM 177

  Fly   184 YFYYMIAAMGPKYQKYIWWKKYLTTFQMVQFV-------AIFTHQFQLLFRECDYPKGFMVWIGL 241
            |.||.:.|.|.:..:.  :...:|..|:.|.:       .:|:...|   .:|......:||..:
 Frog   178 YSYYALRAAGFRVSRK--FAMLITLSQITQMIIGCVVNYLVFSWMQQ---GQCPSHVQNIVWSSI 237

  Fly   242 HGVMFLFLFSDFYKAKYLNAARRRRQA 268
            ..:.:..||..|:...|:...|:..:|
 Frog   238 MYLSYFVLFCHFFFEAYITKTRKASKA 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 68/259 (26%)
elovl6NP_001017257.2 ELO 25..262 CDD:366492 72/279 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.