DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and Elovl2

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_062296.1 Gene:Elovl2 / 54326 MGIID:1858960 Length:292 Species:Mus musculus


Alignment Length:288 Identity:113/288 - (39%)
Similarity:159/288 - (55%) Gaps:18/288 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YRDLMDNKSDPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTI 76
            :.|.|....|.||..:|||.|.|||..:.|.| ..|..||.:.|..|..:.||.:|.:||...|:
Mouse    14 FLDNMFGPRDSRVRGWFLLDSYLPTFILTITY-LLSIWLGNKYMKNRPALSLRGILTLYNLAITL 77

  Fly    77 FSAWIFYEYLMSGWWGHYSLKCQPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILRKKNEH 141
            .||::..|.::|.|.|.|:|:||.:|.:..| .:|:..:.||||.||..||.||:||:||||...
Mouse    78 LSAYMLVELILSSWEGGYNLQCQNLDSAGEG-DVRVAKVLWWYYFSKLVEFLDTIFFVLRKKTNQ 141

  Fly   142 VSTLHVIHHGCMPFSV-WMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKY 205
            ::.|||.||..| |:: |..|.:.|.|.|.|...||||:||:||.||.::.. |...||:|||||
Mouse   142 ITFLHVYHHASM-FNIWWCVLNWIPCGQSFFGPTLNSFIHILMYSYYGLSVF-PSMHKYLWWKKY 204

  Fly   206 LTTFQMVQFVAIFTHQFQLLFRECDYPKGFMVWIGLHGVMFLFLFSDFYKAKYLNAARRRRQAVK 270
            ||..|:||||...||....:.:.|.:|.|.:::...:.:..:.||.:||...|      |::.||
Mouse   205 LTQAQLVQFVLTITHTLSAVVKPCGFPFGCLIFQSSYMMTLVILFLNFYIQTY------RKKPVK 263

  Fly   271 ANGYANGSASNGHSK-HLGEGDALIANG 297
            .. .......||..| ||     ::|||
Mouse   264 KE-LQEKEVKNGFPKAHL-----IVANG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 97/237 (41%)
Elovl2NP_062296.1 ELO 30..264 CDD:307345 99/243 (41%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03202 289..292
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.