DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and CG16904

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_649957.1 Gene:CG16904 / 41212 FlyBaseID:FBgn0037763 Length:262 Species:Drosophila melanogaster


Alignment Length:244 Identity:83/244 - (34%)
Similarity:120/244 - (49%) Gaps:22/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFSAWIFYEYLMSGWWG-H-------YSLKCQ 99
            |..|...||.:||.|.:.::||.||..||..|.:|::.||.       || |       |:|.|.
  Fly    31 YLLFVLKLGRKLMDKHEALQLRGVLKFYNIGQVLFNSVIFV-------WGIHLLFVQKPYNLSCM 88

  Fly   100 PVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILRKKNEHVSTLHVIHHGCMPFSVWMGLKF- 163
            .|......|......:.:.|:::|..:..||:||:||||...::.|||.||..|.|:..|.::| 
  Fly    89 QVLPQDHELKSTERTLSYMYHLNKVLDLMDTIFFVLRKKQRQITFLHVFHHVFMVFTSHMLIRFY 153

  Fly   164 APGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLTTFQMVQFVAIFTHQFQLLFR- 227
            ..|||.....:.|..||||||.||..::.....|:.:|||||||..|:|||:.:|.|.....|: 
  Fly   154 GFGGHVFLICMFNVLVHIVMYGYYYASSQSQNVQESLWWKKYLTLGQLVQFLLMFLHCMYTYFQP 218

  Fly   228 ECDYPKGFMVWIGLHGVMFLFLFSDFYKAKYLNAARRRRQAVKANGYAN 276
            .|...:|.:..|.........:|:.||...|:     |.:.||:.|..|
  Fly   219 NCSASRGVIYVISSASAFMFLMFTKFYIKTYI-----RPKEVKSKGKVN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 78/231 (34%)
CG16904NP_649957.1 ELO 16..257 CDD:279492 80/237 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449633
Domainoid 1 1.000 104 1.000 Domainoid score I2221
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I2130
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.