DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and eloF

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_649956.1 Gene:eloF / 41211 FlyBaseID:FBgn0037762 Length:257 Species:Drosophila melanogaster


Alignment Length:246 Identity:78/246 - (31%)
Similarity:124/246 - (50%) Gaps:17/246 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFSAWIF-----YEYLMS 88
            ::|:|..|:...|.|..|...|||::|..|||..|..|:.:||..|.:::..|.     :.:::.
  Fly    12 VVSNPWITMGTLIGYLLFVLKLGPKIMEHRKPFHLNGVIRIYNIFQILYNGLILVLGVHFLFVLK 76

  Fly    89 GWWGHYSLKC---QPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILRKKNEHVSTLHVIHH 150
            .    |.:.|   .|:|:....   |...||..|.::||.:..:|:||:||||:..:|.|||.||
  Fly    77 A----YQISCIVSLPMDHKYKD---RERLICTLYLVNKFVDLVETIFFVLRKKDRQISFLHVFHH 134

  Fly   151 GCMPFSVWMGLKF-APGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLTTFQMVQF 214
            ..|.|..::...| ..||.:....|||:.||::||.||.::::..:.|:.:|||||:|..|:|||
  Fly   135 FAMAFFGYLYYCFHGYGGVAFPQCLLNTAVHVIMYAYYYLSSISKEVQRSLWWKKYITIAQLVQF 199

  Fly   215 VAIFTH-QFQLLFRECDYPKGFMVWIGLHGVMFLFLFSDFYKAKYLNAARR 264
            ..|..| ...|....|...:......|.....|..:||.||...|:...::
  Fly   200 AIILLHCTITLAQPNCAVNRPLTYGCGSLSAFFAVIFSQFYYHNYIKPGKK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 78/246 (32%)
eloFNP_649956.1 ELO 11..252 CDD:279492 78/246 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449654
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.