DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and CG17821

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster


Alignment Length:257 Identity:78/257 - (30%)
Similarity:127/257 - (49%) Gaps:34/257 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFSAWIFYEYLMSGWW-- 91
            :..:|||.:.:.:.|......:||..|..|||..:|..:::||..|.:.::.||   ||..::  
  Fly    21 MFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQVLMNSGIF---LMGTYYLF 82

  Fly    92 --GHYSLKCQPVDYSTTGLAMRMVN-----------ICWWYYISKFTEFFDTLFFILRKKNEHVS 143
              ..|..:|           |.|::           :.::|:|:|..:..||:||:|||.|:.::
  Fly    83 IKKLYDFRC-----------MTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKSNKQIT 136

  Fly   144 TLHVIHHGCMPFSVWMGLKF-APGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLT 207
            .|||.||..|...|.:...| .|||.......||||||:|||.||..:|..|..:...|||:|:|
  Fly   137 VLHVYHHVFMVLGVPLTYYFYGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWWKEYIT 201

  Fly   208 TFQMVQFVAIFTHQFQLLFRE--CDYPKGFMVWIGLHG-VMFLFLFSDFYKAKYLNAARRRR 266
            ..|.:||:.:|......|:..  |.:|| .:.::.|.| |..:.:|.:||...|:.|..:.:
  Fly   202 KLQFLQFMILFAQSVLTLWLNPGCRFPK-VLQYVQLGGSVSMMTMFGNFYYQTYVKAKSKEQ 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 78/254 (31%)
CG17821NP_725820.2 ELO 20..262 CDD:279492 78/255 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449618
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.