DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and tea

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_724855.2 Gene:tea / 36027 FlyBaseID:FBgn0285892 Length:1878 Species:Drosophila melanogaster


Alignment Length:83 Identity:19/83 - (22%)
Similarity:32/83 - (38%) Gaps:9/83 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   255 KAKYLNAARRRRQAVKANGYANGSASNGHSKHLGEGDALIANGC--NTGACMPVMEDEYVKSKGQ 317
            |.|.::|..........| ..|.....|.:|.|.:|..:...|.  |..:.:...|::::..:. 
  Fly  1127 KIKMIHAESSNNSRNSTN-RPNTEIEAGSTKILEDGARVTTEGNSENENSSVEKKENQFLLERA- 1189

  Fly   318 SNGAYKEGFFKEGVLSNN 335
                 ||.||.||...:|
  Fly  1190 -----KEIFFAEGSKDHN 1202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 3/9 (33%)
teaNP_724855.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.