DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and elovl6

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_955826.1 Gene:elovl6 / 317738 ZFINID:ZDB-GENE-030114-1 Length:266 Species:Danio rerio


Alignment Length:292 Identity:81/292 - (27%)
Similarity:119/292 - (40%) Gaps:75/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EAQKWYRDLMDN--KSDPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPR-LMAKRKPMELRSVLV 68
            ||.:|   :.:|  ||       ||.|:   ....||        ||.| :|.:|:..|||..||
Zfish    19 EAIRW---MQENWKKS-------FLFSA---LYAACI--------LGGRHVMKQREKFELRKPLV 62

  Fly    69 VYNAIQTIFSAWIFYEYLMSGWWGHYSLKCQPVDYSTTGLAMRMVNIC-----------WWYY-- 120
            :::.....||  ||......|:..:..:        |.||..   ::|           :|.|  
Zfish    63 LWSLTLAAFS--IFGAIRTGGYMVNILM--------TKGLKQ---SVCDQSFYNGPVSKFWAYAF 114

  Fly   121 -ISKFTEFFDTLFFILRKKNEHVSTLHVIHHGCMPFSVWMGLK--FAPGGHSTFFALLNSFVHIV 182
             :||..|..||||.:|||  :.:..||..||..:....|...|  .|.||   :|..:|..||.|
Zfish   115 VLSKAPELGDTLFIVLRK--QKLIFLHWYHHITVLLYSWYSYKDMVAGGG---WFMTMNYLVHAV 174

  Fly   183 MYFYYMIAAMGPKYQKYIWWKKYLTTFQMVQFVA---------IFTHQFQLLFRECDYPKGFMVW 238
            ||.||.:.|.|.|..:.  :..::|..|:.|.|.         ::..|.|    ||......:||
Zfish   175 MYSYYALRAAGFKISRK--FAMFITLTQITQMVMGCVVNYLVYLWMQQGQ----ECPSHVQNIVW 233

  Fly   239 IGLHGVMFLFLFSDFYKAKYLNAARRRRQAVK 270
            ..|..:.:..||..|:...|:  .:|:..|.|
Zfish   234 SSLMYLSYFVLFCQFFFEAYI--TKRKSNAAK 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 72/262 (27%)
elovl6NP_955826.1 ELO 23..261 CDD:279492 77/284 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.