DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and Elovl3

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_001101072.1 Gene:Elovl3 / 309449 RGDID:1307263 Length:271 Species:Rattus norvegicus


Alignment Length:268 Identity:69/268 - (25%)
Similarity:104/268 - (38%) Gaps:65/268 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 VNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFS------AWIF 82
            |:.||::   |..|.:.||        |...|..||...|:..|::::....|||      .|.|
  Rat    36 VSSFFIV---LVYLLLIIF--------GQNYMKTRKGFSLQRPLILWSFCLAIFSILGTLRMWKF 89

  Fly    83 YEYLMSGWWGHYSLKCQPVDYSTTGLAMRMVNIC--------------WWYYISKFTEFFDTLFF 133
            ...::                .|.||..   .:|              |.:.:||..|..||.|.
  Rat    90 MGTVL----------------FTMGLKQ---TVCFTDYTNDAIVKFWSWVFLLSKVVELGDTAFI 135

  Fly   134 ILRKKNEHVSTLHVIHHGCMPFSVWMGLK-FAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQ 197
            ||||:  .:..:|..||..:......|.| ..|.|  .:|..:|..||.|||.||.:.|...|:.
  Rat   136 ILRKR--PLIFVHWYHHSTVLLFTSFGYKNKVPSG--GWFMTMNLGVHSVMYTYYTMKAAKVKHP 196

  Fly   198 KYIWWKKYLTTFQMVQFV--AIFTHQFQLLFRE---CDYPKGFMVW-IGLHGVMFLFLFSDFYKA 256
            ..:  ...:|:.|::|.|  .|| .....::|:   |........| ..|:|..|: ||:.|:..
  Rat   197 NIL--PMVITSLQILQMVLGTIF-GILNYIWRQERGCYTTSEHFFWSFVLYGTYFI-LFAQFFHR 257

  Fly   257 KYLNAARR 264
            .||...|:
  Rat   258 AYLRPKRK 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 67/264 (25%)
Elovl3NP_001101072.1 ELO 30..266 CDD:279492 69/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.