DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and SPAC1B2.03c

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_593930.1 Gene:SPAC1B2.03c / 2542505 PomBaseID:SPAC1B2.03c Length:334 Species:Schizosaccharomyces pombe


Alignment Length:269 Identity:78/269 - (28%)
Similarity:129/269 - (47%) Gaps:59/269 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AYFSKSL-GPRLMAKRKPMELRSVLVVYNAIQTIFSA--------WIFYEYLMSGWWGHYSLKCQ 99
            ||:...| |..:|..|||::.|.:..::|.|.||.|.        .:|..|:.:|.:  |.: |.
pombe    64 AYYVIILSGRAIMTNRKPLKQRRLFQLHNFILTIISGALLALLVEEVFRNYMRNGLF--YCV-CD 125

  Fly   100 PVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILRKKNEHVSTLHVIHHG---CMPFSVWMGL 161
            ...::     .|:|.:.:..|::|:.|..||:|..|:||  .::.||..|||   .:.|:..:|.
pombe   126 SRHFT-----QRLVTLYYLNYLTKYLELMDTVFLFLKKK--PLAFLHCYHHGITALLCFTQLLGR 183

  Fly   162 KFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLTTFQMVQFV--------AIF 218
            .....|    ...||.:||::||.||.:||.|    :.:|||:::|..|::|||        ..:
pombe   184 TSVQWG----VIGLNLYVHVIMYSYYFLAACG----RRVWWKQWVTRVQIIQFVLDLILCYFGTY 240

  Fly   219 THQFQLLFR---------ECDYPKG--FMVWIGLHGVM--FLFLFSDFYKAKYLNAARRRRQAVK 270
            :|   :.||         :|   .|  |..:.|. ||:  :||||..||...|:....::.|. |
pombe   241 SH---IAFRYFPWLPHVGDC---SGSLFAAFFGC-GVLSSYLFLFIGFYINTYIKRGAKKNQR-K 297

  Fly   271 ANGYANGSA 279
            |.|.|:.::
pombe   298 AAGKADNTS 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 73/253 (29%)
SPAC1B2.03cNP_593930.1 ELO 50..294 CDD:279492 73/254 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 1 0.900 - - OOG6_100254
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
87.760

Return to query results.
Submit another query.