DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and elo-1

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_501689.1 Gene:elo-1 / 177787 WormBaseID:WBGene00001239 Length:288 Species:Caenorhabditis elegans


Alignment Length:237 Identity:61/237 - (25%)
Similarity:100/237 - (42%) Gaps:41/237 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 MAKRKPMELRSVLVVYNAIQTIFSAWIFYEYLMSGWWGHYSLKCQPVDYSTTGLAMRMVNIC--- 116
            |..|:|.:|...|.::|.|...||        ::|     ::|..|..:.|......:.:.|   
 Worm    65 MRNRQPFQLTIPLNIWNFILAAFS--------IAG-----AVKMTPEFFGTIANKGIVASYCKVF 116

  Fly   117 -----------WWYYISKFTEFFDTLFFILRKKNEHVSTLHVIHHGCMPFSVWMGLKFAPGGHST 170
                       |.:..||..|..||:|.:|||:  .:..||..||.......|......| |.:.
 Worm   117 DFTKGENGYWVWLFMASKLFELVDTIFLVLRKR--PLMFLHWYHHILTMIYAWYSHPLTP-GFNR 178

  Fly   171 FFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLTTFQMVQFV---AIFTHQFQLLF---REC 229
            :...||..||..||.||.:.:|..:...:|  .:.:|:.|:|||:   |:..|...|:.   ..|
 Worm   179 YGIYLNFVVHAFMYSYYFLRSMKIRVPGFI--AQAITSLQIVQFIISCAVLAHLGYLMHFTNANC 241

  Fly   230 DY-PKGFMVWIGLHGVMFLFLFSDFYKAKY-LNAARRRRQAV 269
            |: |..|.:.:.: ...:|.||.:|:...| |...:.:.:||
 Worm   242 DFEPSVFKLAVFM-DTTYLALFVNFFLQSYVLRGGKDKYKAV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 59/231 (26%)
elo-1NP_501689.1 ELO 39..278 CDD:279492 59/231 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2719
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.