DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and elo-6

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_500797.1 Gene:elo-6 / 177321 WormBaseID:WBGene00001244 Length:274 Species:Caenorhabditis elegans


Alignment Length:234 Identity:69/234 - (29%)
Similarity:106/234 - (45%) Gaps:33/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LMAKRKPMELRSVLVVYNAIQTIFSA--------WIFYEYLMSGWWGHYSLKCQPVDYSTTGLAM 110
            :|..|||.:|...|.::||...|||.        .:.:|:...|::..| :.........:|:  
 Worm    50 VMTNRKPFDLTGPLNLWNAGLAIFSTLGSLATTFGLLHEFFSRGFFESY-IHIGDFYNGLSGM-- 111

  Fly   111 RMVNICWWYYISKFTEFFDTLFFILRKKNEHVSTLHVIHHGCMPFSVWMGLKFAPGGHSTFFALL 175
                ..|.:.:||..||.||||.|||||  .:..||..||.......:|..: |..|.:|:...:
 Worm   112 ----FTWLFVLSKVAEFGDTLFIILRKK--PLMFLHWYHHVLTMNYAFMSFE-ANLGFNTWITWM 169

  Fly   176 NSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLTTFQMVQFVAIFTHQFQLLF---------RECDY 231
            |..||.:||.|||:.:.|.|..  .|..|.:||.|::|||  .||  .:||         :..|.
 Worm   170 NFSVHSIMYGYYMLRSFGVKVP--AWIAKNITTMQILQFV--ITH--FILFHVGYLAVTGQSVDS 228

  Fly   232 PKGFMVWIGLHGVMFLFLFSDFYKAKYLNAARRRRQAVK 270
            ..|:..:..|..:.::.||.:||...|:....::..|.|
 Worm   229 TPGYYWFCLLMEISYVVLFGNFYYQSYIKGGGKKFNAEK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 67/227 (30%)
elo-6NP_500797.1 ELO 33..262 CDD:279492 67/227 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.