DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and Elovl6

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_599210.1 Gene:Elovl6 / 171402 RGDID:620585 Length:267 Species:Rattus norvegicus


Alignment Length:298 Identity:79/298 - (26%)
Similarity:118/298 - (39%) Gaps:88/298 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EAQKWYRDLMDN--KSDPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVV 69
            ||.:|   :.:|  ||       ||.|:         .||.|... |..||.||...|||..||:
  Rat    21 EAIQW---MQENWKKS-------FLFSA---------LYAAFIFG-GRHLMNKRAKFELRKPLVL 65

  Fly    70 YNAIQTIFSAWIFYEYLMSGWWGHYSLKCQPVDYSTTGLAMRMVNIC-----------WWYY--- 120
            ::....:||   .:..|.:|.:..|.|       .|.||..   ::|           :|.|   
  Rat    66 WSLTLAVFS---IFGALRTGAYMLYIL-------MTKGLKQ---SVCDQSFYNGPVSKFWAYAFV 117

  Fly   121 ISKFTEFFDTLFFILRKKNEHVSTLHVIHHGCMPFSVWMGLK--FAPGGHSTFFALLNSFVHIVM 183
            :||..|..||:|.||||  :.:..||..||..:....|...|  .|.||   :|..:|..||.||
  Rat   118 LSKAPELGDTIFIILRK--QKLIFLHWYHHITVLLYSWYSYKDMVAGGG---WFMTMNYGVHAVM 177

  Fly   184 YFYYMIAAMGPKYQKYIWWKKYLTTFQMVQFV------------------AIFTHQFQLLFRECD 230
            |.||.:.|.|.:..:.  :..::|..|:.|.:                  ..::| ||.:|    
  Rat   178 YSYYALRAAGFRVSRK--FAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSH-FQNIF---- 235

  Fly   231 YPKGFMVWIGLHGVMFLFLFSDFYKAKYLNAARRRRQA 268
                   |..|..:.:|.||..|:...|:...::..:|
  Rat   236 -------WSSLMYLSYLLLFCHFFFEAYIGKVKKATKA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 72/270 (27%)
Elovl6NP_599210.1 ELO 25..264 CDD:395916 76/290 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.