DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and Elovl3

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_031729.1 Gene:Elovl3 / 12686 MGIID:1195976 Length:271 Species:Mus musculus


Alignment Length:237 Identity:62/237 - (26%)
Similarity:93/237 - (39%) Gaps:54/237 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LGPRLMAKRKPMELRSVLVVYNAIQTIFS------AWIFYEYLMSGWWGHYSLKCQPVDYSTTGL 108
            :|...|..||...|:..|::::....|||      .|.|...:|                .|.||
Mouse    51 VGQTYMRTRKSFSLQRPLILWSFFLAIFSILGTLRMWKFMATVM----------------FTVGL 99

  Fly   109 AMRMVNIC-----------WW---YYISKFTEFFDTLFFILRKKNEHVSTLHVIHHGCMPFSVWM 159
            ..   .:|           :|   :.:||..|..||.|.||||:  .:..:|..||..:......
Mouse   100 KQ---TVCFAIYTDDAVVRFWSFLFLLSKVVELGDTAFIILRKR--PLIFVHWYHHSTVLLFTSF 159

  Fly   160 GLK-FAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLTTFQMVQFV--AIFTHQ 221
            |.| ..|.|  .:|..:|..||.|||.||.:.|...|:...:  ...:|:.|::|.|  .|| ..
Mouse   160 GYKNKVPSG--GWFMTMNFGVHSVMYTYYTMKAAKLKHPNLL--PMVITSLQILQMVLGTIF-GI 219

  Fly   222 FQLLFRE---CDYPKGFMVW-IGLHGVMFLFLFSDFYKAKYL 259
            ...::|:   |........| ..|:|..|: ||:.|:...||
Mouse   220 LNYIWRQEKGCHTTTEHFFWSFMLYGTYFI-LFAHFFHRAYL 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 62/237 (26%)
Elovl3NP_031729.1 ELO 52..267 CDD:366492 62/236 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.