DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and elovl4

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:XP_002936253.1 Gene:elovl4 / 100496222 XenbaseID:XB-GENE-953769 Length:328 Species:Xenopus tropicalis


Alignment Length:324 Identity:128/324 - (39%)
Similarity:182/324 - (56%) Gaps:21/324 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ILQEAQKWYRDLMDNKSDPRVNDFFLLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLV 68
            ::|...:.| |...:.:|.||..:.|:.||||||.:...| .....|||:.|..|:|.:||.:|:
 Frog     8 VIQRTLQLY-DWCFSIADKRVEKWPLMQSPLPTLAISTAY-LLVVWLGPKFMKNREPFQLRYLLI 70

  Fly    69 VYNAIQTIFSAWIFYEYLMSGWWGHYSLKCQPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFF 133
            .||....|.:.:||.|..:......||..|||||||.....:|:.:..||||:||..|:|||:||
 Frog    71 AYNFGMVILNFFIFKELFLGAKAAGYSYICQPVDYSDDENEVRVASALWWYYVSKGVEYFDTVFF 135

  Fly   134 ILRKKNEHVSTLHVIHHGCMPFSV-WMGLKFAPGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQ 197
            |||||...:|.|||.|| |..|:: |:|:|:..||.|.|.|.:|:.:|:|||.||.:||.||..|
 Frog   136 ILRKKFNQISFLHVYHH-CTMFTLWWIGIKWVAGGQSFFGAHMNALIHVVMYLYYGLAACGPHLQ 199

  Fly   198 KYIWWKKYLTTFQMVQFVAIFTHQFQLLFRECDYPKGFMVW-IGLHGVMFLFLFSDFYKAKYLNA 261
            ||:|||:|||..|:|||.....|....|:.:|.:|| :|.| :.::.:.|:.||.:||...| ||
 Frog   200 KYLWWKRYLTILQLVQFHVTIGHTALSLYIDCPFPK-WMHWALIVYAITFIILFVNFYYRTY-NA 262

  Fly   262 ----ARRRRQAVKANGYANGSAS-NGHSKHLGEGDALIANGCNTGACMPVMEDEYVKSKGQSNG 320
                |:..:..:......||.:| ||..:..|:    :.||...||..  .:|..|   ||.||
 Frog   263 PKAPAKSGKSLINGKTSVNGKSSVNGKCQINGK----LMNGAVNGAVS--KQDNKV---GQENG 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 106/242 (44%)
elovl4XP_002936253.1 ELO 31..268 CDD:366492 105/240 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.