DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31523 and elovl6l

DIOPT Version :9

Sequence 1:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster
Sequence 2:NP_958908.1 Gene:elovl6l / 100150288 ZFINID:ZDB-GENE-031110-3 Length:268 Species:Danio rerio


Alignment Length:234 Identity:62/234 - (26%)
Similarity:101/234 - (43%) Gaps:42/234 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 GPRLMAKRKPMELRSVLVVYNAIQTIFSAWIFYEYLMSGWWGHYSLKCQPVDYSTTGLAMRMVNI 115
            |...|..|:.::||.||::::....|||   ....:.:|.:..|.|       ||:|...   ::
Zfish    49 GQHFMKDRQRLDLRKVLMMWSLSLAIFS---IIGAVRTGCFMLYIL-------STSGFKQ---SV 100

  Fly   116 C-----------WW---YYISKFTEFFDTLFFILRKKNEHVSTLHVIHHGCMPFSVWMGLK--FA 164
            |           :|   :.:||..|..||:|.:|||  :.:..||..||..:....|...|  .|
Zfish   101 CDQSFYYGPISKFWACAFVLSKAPELGDTMFIVLRK--QRLIFLHWYHHITVLVYSWYSYKDQVA 163

  Fly   165 PGGHSTFFALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLTTFQMVQFVAIFTHQFQLLFR-- 227
            .||   :|..:|..||.:||.||...|.|.:..|..   ..|.|...:..:|:......|::|  
Zfish   164 GGG---WFMTMNYTVHALMYSYYAARAAGLRVPKPC---AILITSSQIAQMAMDLAVSALVYRWM 222

  Fly   228 ---ECDYPKGFMVWIGLHGVMFLFLFSDFYKAKYLNAAR 263
               :|......:||..|..:.:|.|||.|:...|:.:::
Zfish   223 QDGDCPSYLDNIVWASLMYLSYLLLFSSFFYQSYMKSSK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31523NP_001262255.1 ELO 28..265 CDD:279492 62/234 (26%)
elovl6lNP_958908.1 ELO 27..264 CDD:279492 62/234 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.