DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31515 and spint2

DIOPT Version :10

Sequence 1:NP_732865.2 Gene:CG31515 / 326147 FlyBaseID:FBgn0051515 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001070718.2 Gene:spint2 / 562009 ZFINID:ZDB-GENE-061013-323 Length:431 Species:Danio rerio


Alignment Length:70 Identity:25/70 - (35%)
Similarity:35/70 - (50%) Gaps:3/70 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DIRRITKMGSYKVRQEKCLFIPSYGRCKKHIAVYGYNIITNRCSEFTYSGCGGNPNRFMTDSQCR 94
            |.:.:|:|.|.:. ||||......|.|:..|..:.||  ...|.:|.|.|||||.|.:.::..|.
Zfish   212 DPKALTEMTSEEF-QEKCQSPAVTGNCRASIKRFYYN--NGVCQQFIYGGCGGNKNNYESEDSCM 273

  Fly    95 NTCYV 99
            ..|.|
Zfish   274 TACTV 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31515NP_732865.2 Kunitz-type 47..97 CDD:438633 16/49 (33%)
spint2NP_001070718.2 MANEC <56..108 CDD:471454
Kunitz-type 133..183 CDD:438633
Kunitz-type 228..276 CDD:438633 16/49 (33%)
Kunitz-type 302..354 CDD:444694
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.