DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31515 and CG42827

DIOPT Version :10

Sequence 1:NP_732865.2 Gene:CG31515 / 326147 FlyBaseID:FBgn0051515 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_651142.3 Gene:CG42827 / 42763 FlyBaseID:FBgn0262009 Length:116 Species:Drosophila melanogaster


Alignment Length:113 Identity:34/113 - (30%)
Similarity:50/113 - (44%) Gaps:6/113 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 TLLWAFFFSTEVFGKVKIRESDIRRITKMGSYKVRQEKCLFIPSYGRCKKHIAVYGYNIITNRCS 73
            |:|..|..:|.:.. :.:....::...:...|.:|::.||....||:||....::.||...::|.
  Fly     4 TILCIFCLATVILA-IDMDSDSLQEQYEREQYNIRKKICLQSSEYGKCKGRRKLWFYNPKKSKCQ 67

  Fly    74 EFTYSGCGGNPNRFMTDSQCRNTCYVV---PARKT--VSEPDYYADDG 116
            .|.||.||||.|.|.|...|...|...   ..|||  ....||...||
  Fly    68 VFIYSNCGGNGNLFYTKESCVEFCGKYDWKKVRKTGLRRSADYRRKDG 115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31515NP_732865.2 Kunitz-type 47..97 CDD:438633 20/49 (41%)
CG42827NP_651142.3 Kunitz-type 41..91 CDD:438633 20/49 (41%)

Return to query results.
Submit another query.