DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31515 and IM33

DIOPT Version :10

Sequence 1:NP_732865.2 Gene:CG31515 / 326147 FlyBaseID:FBgn0051515 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_608800.1 Gene:IM33 / 33592 FlyBaseID:FBgn0031561 Length:82 Species:Drosophila melanogaster


Alignment Length:53 Identity:23/53 - (43%)
Similarity:26/53 - (49%) Gaps:11/53 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 KC-LFIPSYGRCKKHIAVYGYNIITNRCSEFTYSGCGGNPNRFMTDSQCRNTC 97
            || .||||          :.|:..||.|.:|.|.|||||.|||.|...|...|
  Fly    38 KCAAFIPS----------FSYHPETNSCEKFIYGGCGGNENRFGTQELCEQKC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31515NP_732865.2 Kunitz-type 47..97 CDD:438633 21/50 (42%)
IM33NP_608800.1 Kunitz_SCI-I-like 24..80 CDD:438677 22/51 (43%)

Return to query results.
Submit another query.