DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31515 and Spint1

DIOPT Version :10

Sequence 1:NP_732865.2 Gene:CG31515 / 326147 FlyBaseID:FBgn0051515 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001004265.2 Gene:Spint1 / 311331 RGDID:1303138 Length:507 Species:Rattus norvegicus


Alignment Length:66 Identity:24/66 - (36%)
Similarity:36/66 - (54%) Gaps:6/66 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 CLFIPSYGRCKKHIAVYGYNIITNRCSEFTYSGCGGNPNRFMTDSQCRNTCYVVPARKTVSEPDY 111
            |..:|..|.||::|..:.||..:.||:.|||.||.||.|.|..:.||..:|      :.:|:.|.
  Rat   369 CAELPDTGFCKENIPRWYYNPFSERCARFTYGGCYGNKNNFEKEQQCLESC------RGISKKDV 427

  Fly   112 Y 112
            :
  Rat   428 F 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31515NP_732865.2 Kunitz-type 47..97 CDD:438633 21/49 (43%)
Spint1NP_001004265.2 MANEC 42..133 CDD:462186
Kunitz_HAI1_1-like 239..297 CDD:438666
LDLa 313..344 CDD:197566
Kunitz_HAI1_2-like 369..428 CDD:438667 24/64 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.