DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31515 and AMBP

DIOPT Version :10

Sequence 1:NP_732865.2 Gene:CG31515 / 326147 FlyBaseID:FBgn0051515 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001624.1 Gene:AMBP / 259 HGNCID:453 Length:352 Species:Homo sapiens


Alignment Length:72 Identity:24/72 - (33%)
Similarity:34/72 - (47%) Gaps:6/72 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IRRITKMGSYKVRQEKCLFIPSYGRCKKHIAVYGYNIITNRCSEFTYSGCGGNPNRFMTDSQCRN 95
            :..:||      :::.|....|.|.|....:.|.||..:..|..|.|.||.||.|.|:|:.:|..
Human   221 VTEVTK------KEDSCQLGYSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFVTEKECLQ 279

  Fly    96 TCYVVPA 102
            ||..|.|
Human   280 TCRTVAA 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31515NP_732865.2 Kunitz-type 47..97 CDD:438633 18/49 (37%)
AMBPNP_001624.1 lipocalin_A1M-like 28..190 CDD:381193
Glycopeptide (secretory piece) 206..226 0/4 (0%)
Kunitz_bikunin_1-like 229..282 CDD:438639 19/52 (37%)
Kunitz_bikunin_2-like 284..338 CDD:438640 2/3 (67%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.