| Sequence 1: | NP_732865.2 | Gene: | CG31515 / 326147 | FlyBaseID: | FBgn0051515 | Length: | 129 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001032954.1 | Gene: | Col28a1 / 213945 | MGIID: | 2685312 | Length: | 1141 | Species: | Mus musculus |
| Alignment Length: | 44 | Identity: | 17/44 - (38%) |
|---|---|---|---|
| Similarity: | 27/44 - (61%) | Gaps: | 0/44 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 54 GRCKKHIAVYGYNIITNRCSEFTYSGCGGNPNRFMTDSQCRNTC 97 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG31515 | NP_732865.2 | Kunitz-type | 47..97 | CDD:438633 | 15/42 (36%) |
| Col28a1 | NP_001032954.1 | vWFA_subfamily_ECM | 47..212 | CDD:238727 | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 242..770 | ||||
| gly_rich_SclB | <257..446 | CDD:468478 | |||
| gly_rich_SclB | <363..632 | CDD:468478 | |||
| gly_rich_SclB | <525..>773 | CDD:468478 | |||
| VWA | 798..974 | CDD:459670 | |||
| Kunitz-type | 1088..1138 | CDD:444694 | 15/42 (36%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||