DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31515 and Col28a1

DIOPT Version :10

Sequence 1:NP_732865.2 Gene:CG31515 / 326147 FlyBaseID:FBgn0051515 Length:129 Species:Drosophila melanogaster
Sequence 2:NP_001032954.1 Gene:Col28a1 / 213945 MGIID:2685312 Length:1141 Species:Mus musculus


Alignment Length:44 Identity:17/44 - (38%)
Similarity:27/44 - (61%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 GRCKKHIAVYGYNIITNRCSEFTYSGCGGNPNRFMTDSQCRNTC 97
            |.|..::..:.|:...|.|:.|.:|||.|:.|||.::.:||.||
Mouse  1095 GECGDYVVRWYYDKQVNSCARFWFSGCNGSGNRFHSEKECRETC 1138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31515NP_732865.2 Kunitz-type 47..97 CDD:438633 15/42 (36%)
Col28a1NP_001032954.1 vWFA_subfamily_ECM 47..212 CDD:238727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..770
gly_rich_SclB <257..446 CDD:468478
gly_rich_SclB <363..632 CDD:468478
gly_rich_SclB <525..>773 CDD:468478
VWA 798..974 CDD:459670
Kunitz-type 1088..1138 CDD:444694 15/42 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.