powered by:
Protein Alignment ATPsynepsilonL and ATP15
DIOPT Version :9
Sequence 1: | NP_001097736.1 |
Gene: | ATPsynepsilonL / 326144 |
FlyBaseID: | FBgn0051477 |
Length: | 64 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_015052.1 |
Gene: | ATP15 / 855857 |
SGDID: | S000006192 |
Length: | 62 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 62 |
Identity: | 23/62 - (37%) |
Similarity: | 35/62 - (56%) |
Gaps: | 5/62 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MKAWRDLGITYIQYSNIAARVVREALRIELR-ADAAKRNISHVKFTPWVNG----KPVPRKK 57
|.|||..||:|..|.|:||:.:|.:|:.||: |....|:.:...:|.:.|| :|.|..|
Yeast 1 MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPITK 62
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
44 |
1.000 |
Domainoid score |
I3136 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3495 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
48 |
1.000 |
Inparanoid score |
I1863 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002155 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm46585 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_103560 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12448 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
9 | 8.820 |
|
Return to query results.
Submit another query.