DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynepsilonL and ATP15

DIOPT Version :9

Sequence 1:NP_001097736.1 Gene:ATPsynepsilonL / 326144 FlyBaseID:FBgn0051477 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_015052.1 Gene:ATP15 / 855857 SGDID:S000006192 Length:62 Species:Saccharomyces cerevisiae


Alignment Length:62 Identity:23/62 - (37%)
Similarity:35/62 - (56%) Gaps:5/62 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAWRDLGITYIQYSNIAARVVREALRIELR-ADAAKRNISHVKFTPWVNG----KPVPRKK 57
            |.|||..||:|..|.|:||:.:|.:|:.||: |....|:.:...:|.:.||    :|.|..|
Yeast     1 MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPITK 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynepsilonLNP_001097736.1 ATP-synt_Eps 3..50 CDD:282481 17/47 (36%)
ATP15NP_015052.1 ATP-synt_Eps 2..51 CDD:398354 17/48 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I3136
eggNOG 1 0.900 - - E1_KOG3495
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 48 1.000 Inparanoid score I1863
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002155
OrthoInspector 1 1.000 - - otm46585
orthoMCL 1 0.900 - - OOG6_103560
Panther 1 1.100 - - O PTHR12448
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.820

Return to query results.
Submit another query.