powered by:
Protein Alignment ATPsynepsilonL and atp5f1e
DIOPT Version :9
Sequence 1: | NP_001097736.1 |
Gene: | ATPsynepsilonL / 326144 |
FlyBaseID: | FBgn0051477 |
Length: | 64 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001289671.1 |
Gene: | atp5f1e / 798291 |
ZFINID: | ZDB-GENE-110411-22 |
Length: | 51 |
Species: | Danio rerio |
Alignment Length: | 40 |
Identity: | 20/40 - (50%) |
Similarity: | 30/40 - (75%) |
Gaps: | 0/40 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 WRDLGITYIQYSNIAARVVREALRIELRADAAKRNISHVK 43
||..|::||:||.|.|||||.||:.:::|:|.|...|:|:
Zfish 5 WRQAGLSYIRYSAICARVVRAALKPQIKAEAIKNAESNVR 44
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
44 |
1.000 |
Domainoid score |
I12300 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3495 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
44 |
1.000 |
Inparanoid score |
I5485 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1628103at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002155 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm26378 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_103560 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR12448 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R9948 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
11 | 10.900 |
|
Return to query results.
Submit another query.