DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ATPsynepsilonL and atp5f1e

DIOPT Version :9

Sequence 1:NP_001097736.1 Gene:ATPsynepsilonL / 326144 FlyBaseID:FBgn0051477 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_001289671.1 Gene:atp5f1e / 798291 ZFINID:ZDB-GENE-110411-22 Length:51 Species:Danio rerio


Alignment Length:40 Identity:20/40 - (50%)
Similarity:30/40 - (75%) Gaps:0/40 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WRDLGITYIQYSNIAARVVREALRIELRADAAKRNISHVK 43
            ||..|::||:||.|.|||||.||:.:::|:|.|...|:|:
Zfish     5 WRQAGLSYIRYSAICARVVRAALKPQIKAEAIKNAESNVR 44

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ATPsynepsilonLNP_001097736.1 ATP-synt_Eps 3..50 CDD:282481 20/40 (50%)
atp5f1eNP_001289671.1 ATP-synt_Eps 3..47 CDD:282481 20/40 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12300
eggNOG 1 0.900 - - E1_KOG3495
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I5485
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1628103at2759
OrthoFinder 1 1.000 - - FOG0002155
OrthoInspector 1 1.000 - - otm26378
orthoMCL 1 0.900 - - OOG6_103560
Panther 1 1.100 - - O PTHR12448
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R9948
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1110.900

Return to query results.
Submit another query.